GGRNA | NM_002398.2

LOCUS       NM_002398               3198 bp    mRNA    linear   PRI 15-JUN-2013
DEFINITION  Homo sapiens Meis homeobox 1 (MEIS1), mRNA.
ACCESSION   NM_002398
VERSION     NM_002398.2  GI:45006902
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3198)
  AUTHORS   Nurnberg,S.T., Rendon,A., Smethurst,P.A., Paul,D.S., Voss,K.,
            Thon,J.N., Lloyd-Jones,H., Sambrook,J.G., Tijssen,M.R.,
            Italiano,J.E. Jr., Deloukas,P., Gottgens,B., Soranzo,N. and
            Ouwehand,W.H.
  CONSRTM   HaemGen Consortium
  TITLE     A GWAS sequence variant for platelet volume marks an alternative
            DNM3 promoter in megakaryocytes near a MEIS1 binding site
  JOURNAL   Blood 120 (24), 4859-4868 (2012)
   PUBMED   22972982
  REMARK    GeneRIF: Data indicate that dynamin 3 (DNM3) harbors MEIS1 binding
            sites and is associated with differences in mean platelet volume
            (MPV).
REFERENCE   2  (bases 1 to 3198)
  AUTHORS   Butler,A.M., Yin,X., Evans,D.S., Nalls,M.A., Smith,E.N., Tanaka,T.,
            Li,G., Buxbaum,S.G., Whitsel,E.A., Alonso,A., Arking,D.E.,
            Benjamin,E.J., Berenson,G.S., Bis,J.C., Chen,W., Deo,R.,
            Ellinor,P.T., Heckbert,S.R., Heiss,G., Hsueh,W.C., Keating,B.J.,
            Kerr,K.F., Li,Y., Limacher,M.C., Liu,Y., Lubitz,S.A.,
            Marciante,K.D., Mehra,R., Meng,Y.A., Newman,A.B., Newton-Cheh,C.,
            North,K.E., Palmer,C.D., Psaty,B.M., Quibrera,P.M., Redline,S.,
            Reiner,A.P., Rotter,J.I., Schnabel,R.B., Schork,N.J.,
            Singleton,A.B., Smith,J.G., Soliman,E.Z., Srinivasan,S.R.,
            Zhang,Z.M., Zonderman,A.B., Ferrucci,L., Murray,S.S., Evans,M.K.,
            Sotoodehnia,N., Magnani,J.W. and Avery,C.L.
  TITLE     Novel loci associated with PR interval in a genome-wide association
            study of 10 African American cohorts
  JOURNAL   Circ Cardiovasc Genet 5 (6), 639-646 (2012)
   PUBMED   23139255
REFERENCE   3  (bases 1 to 3198)
  AUTHORS   Woolthuis,C.M., Han,L., Verkaik-Schakel,R.N., van Gosliga,D.,
            Kluin,P.M., Vellenga,E., Schuringa,J.J. and Huls,G.
  TITLE     Downregulation of MEIS1 impairs long-term expansion of CD34+
            NPM1-mutated acute myeloid leukemia cells
  JOURNAL   Leukemia 26 (4), 848-853 (2012)
   PUBMED   21986840
  REMARK    GeneRIF: the cellular context in which HOX/MEIS1 is overexpressed
            appears to be very important, and other relevant genes are most
            likely required as well to maintain the expanding capacity of the
            CD34thorn NPMcthorn acute myeloid leukemia cells
REFERENCE   4  (bases 1 to 3198)
  AUTHORS   Li,Z., Huang,H., Chen,P., He,M., Li,Y., Arnovitz,S., Jiang,X.,
            He,C., Hyjek,E., Zhang,J., Zhang,Z., Elkahloun,A., Cao,D., Shen,C.,
            Wunderlich,M., Wang,Y., Neilly,M.B., Jin,J., Wei,M., Lu,J.,
            Valk,P.J., Delwel,R., Lowenberg,B., Le Beau,M.M., Vardiman,J.,
            Mulloy,J.C., Zeleznik-Le,N.J., Liu,P.P., Zhang,J. and Chen,J.
  TITLE     miR-196b directly targets both HOXA9/MEIS1 oncogenes and FAS tumour
            suppressor in MLL-rearranged leukaemia
  JOURNAL   Nat Commun 3, 688 (2012)
   PUBMED   22353710
  REMARK    GeneRIF: findings show that HOXA9 and MEIS1 are direct targets of
            miRNA-196b, a microRNA located adjacent to and co-expressed with
            HOXA9, in MLL-rearranged leukaemic cells
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 3198)
  AUTHORS   Rosales-Avina,J.A., Torres-Flores,J., Aguilar-Lemarroy,A.,
            Gurrola-Diaz,C., Hernandez-Flores,G., Ortiz-Lazareno,P.C.,
            Lerma-Diaz,J.M., de Celis,R., Gonzalez-Ramella,O.,
            Barrera-Chaires,E., Bravo-Cuellar,A. and Jave-Suarez,L.F.
  TITLE     MEIS1, PREP1, and PBX4 are differentially expressed in acute
            lymphoblastic leukemia: association of MEIS1 expression with higher
            proliferation and chemotherapy resistance
  JOURNAL   J. Exp. Clin. Cancer Res. 30, 112 (2011)
   PUBMED   22185299
  REMARK    GeneRIF: up-regulation of MEIS1 is important for sustaining
            proliferation of leukemic cells and that down-regulation of MEIS1
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 3198)
  AUTHORS   Knoepfler,P.S., Calvo,K.R., Chen,H., Antonarakis,S.E. and
            Kamps,M.P.
  TITLE     Meis1 and pKnox1 bind DNA cooperatively with Pbx1 utilizing an
            interaction surface disrupted in oncoprotein E2a-Pbx1
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 94 (26), 14553-14558 (1997)
   PUBMED   9405651
REFERENCE   7  (bases 1 to 3198)
  AUTHORS   Shen,W.F., Montgomery,J.C., Rozenfeld,S., Moskow,J.J.,
            Lawrence,H.J., Buchberg,A.M. and Largman,C.
  TITLE     AbdB-like Hox proteins stabilize DNA binding by the Meis1
            homeodomain proteins
  JOURNAL   Mol. Cell. Biol. 17 (11), 6448-6458 (1997)
   PUBMED   9343407
REFERENCE   8  (bases 1 to 3198)
  AUTHORS   Smith,J.E. Jr., Bollekens,J.A., Inghirami,G. and Takeshita,K.
  TITLE     Cloning and mapping of the MEIS1 gene, the human homolog of a
            murine leukemogenic gene
  JOURNAL   Genomics 43 (1), 99-103 (1997)
   PUBMED   9226379
REFERENCE   9  (bases 1 to 3198)
  AUTHORS   Steelman,S., Moskow,J.J., Muzynski,K., North,C., Druck,T.,
            Montgomery,J.C., Huebner,K., Daar,I.O. and Buchberg,A.M.
  TITLE     Identification of a conserved family of Meis1-related homeobox
            genes
  JOURNAL   Genome Res. 7 (2), 142-156 (1997)
   PUBMED   9049632
REFERENCE   10 (bases 1 to 3198)
  AUTHORS   Moskow,J.J., Bullrich,F., Huebner,K., Daar,I.O. and Buchberg,A.M.
  TITLE     Meis1, a PBX1-related homeobox gene involved in myeloid leukemia in
            BXH-2 mice
  JOURNAL   Mol. Cell. Biol. 15 (10), 5434-5443 (1995)
   PUBMED   7565694
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BC043503.1, AL832770.1,
            AI203963.1, U85707.1 and CB854199.1.
            This sequence is a reference standard in the RefSeqGene project.
            On Mar 4, 2004 this sequence version replaced gi:4505150.
            
            Summary: Homeobox genes, of which the most well-characterized
            category is represented by the HOX genes, play a crucial role in
            normal development. In addition, several homeoproteins are involved
            in neoplasia. This gene encodes a homeobox protein belonging to the
            TALE ('three amino acid loop extension') family of
            homeodomain-containing proteins. [provided by RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U85707.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025083, ERS025084 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-167               BC043503.1         1-167
            168-344             AL832770.1         182-358
            345-384             AI203963.1         9-48
            385-1667            BC043503.1         380-1662
            1668-2903           U85707.1           1276-2511
            2904-3198           CB854199.1         1-295               c
FEATURES             Location/Qualifiers
     source          1..3198
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="2"
                     /map="2p14"
     gene            1..3198
                     /gene="MEIS1"
                     /note="Meis homeobox 1"
                     /db_xref="GeneID:4211"
                     /db_xref="HGNC:7000"
                     /db_xref="HPRD:03442"
                     /db_xref="MIM:601739"
     exon            1..469
                     /gene="MEIS1"
                     /inference="alignment:Splign:1.39.8"
     variation       143
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1568319"
     variation       202..203
                     /gene="MEIS1"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:142644762"
     variation       225
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189623696"
     variation       256
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:180881304"
     variation       293
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2139244"
     variation       323
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372365155"
     variation       342
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:35787275"
     variation       346
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2901852"
     variation       357
                     /gene="MEIS1"
                     /replace=""
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:10585479"
     variation       366..368
                     /gene="MEIS1"
                     /replace=""
                     /replace="t"
                     /replace="ttt"
                     /db_xref="dbSNP:10594206"
     variation       367..368
                     /gene="MEIS1"
                     /replace=""
                     /replace="tt"
                     /db_xref="dbSNP:70943697"
     variation       376
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201967957"
     misc_feature    380..382
                     /gene="MEIS1"
                     /note="upstream in-frame stop codon"
     variation       393
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375185484"
     variation       417
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:71411941"
     variation       424
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367818704"
     variation       428
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186107745"
     CDS             458..1630
                     /gene="MEIS1"
                     /note="WUGSC:H_NH0444B04.1; leukemogenic homolog protein;
                     Meis1, myeloid ecotropic viral integration site 1 homolog"
                     /codon_start=1
                     /product="homeobox protein Meis1"
                     /protein_id="NP_002389.1"
                     /db_xref="GI:4505151"
                     /db_xref="CCDS:CCDS46309.1"
                     /db_xref="GeneID:4211"
                     /db_xref="HGNC:7000"
                     /db_xref="HPRD:03442"
                     /db_xref="MIM:601739"
                     /translation="

MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM

"
     misc_feature    671..673
                     /gene="MEIS1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="sumoylation site; modified site"
     misc_feature    1043..1045
                     /gene="MEIS1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    1049..1051
                     /gene="MEIS1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    1283..1444
                     /gene="MEIS1"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(1283..1288,1292..1294,1352..1354,1370..1372,
                     1409..1411,1415..1420,1427..1432,1436..1444)
                     /gene="MEIS1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(1289..1291,1418..1420,1427..1432,1439..1441)
                     /gene="MEIS1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    1460..1627
                     /gene="MEIS1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O00470.1);
                     Region: Required for transcriptional activation (By
                     similarity)"
     variation       469
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371461925"
     exon            470..696
                     /gene="MEIS1"
                     /inference="alignment:Splign:1.39.8"
     variation       479
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201221821"
     variation       535
                     /gene="MEIS1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200427772"
     STS             538..670
                     /gene="MEIS1"
                     /standard_name="PMC343796P1"
                     /db_xref="UniSTS:273190"
     variation       548
                     /gene="MEIS1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:375684991"
     variation       561
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367951046"
     variation       606
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372202666"
     variation       661
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375784028"
     variation       684
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35067867"
     exon            697..838
                     /gene="MEIS1"
                     /inference="alignment:Splign:1.39.8"
     variation       769
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184168259"
     variation       810
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202151942"
     exon            839..889
                     /gene="MEIS1"
                     /inference="alignment:Splign:1.39.8"
     exon            890..940
                     /gene="MEIS1"
                     /inference="alignment:Splign:1.39.8"
     variation       895
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368344281"
     exon            941..1087
                     /gene="MEIS1"
                     /inference="alignment:Splign:1.39.8"
     variation       1024
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375874864"
     variation       1064
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369833361"
     exon            1088..1199
                     /gene="MEIS1"
                     /inference="alignment:Splign:1.39.8"
     variation       1111
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373697250"
     variation       1116
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376358636"
     variation       1128
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199516222"
     variation       1156
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372577277"
     variation       1177
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201336020"
     variation       1183
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377466642"
     variation       1195
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1135875"
     exon            1200..1345
                     /gene="MEIS1"
                     /inference="alignment:Splign:1.39.8"
     variation       1217
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61752692"
     variation       1272
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61752693"
     variation       1297
                     /gene="MEIS1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:77573142"
     exon            1346..1422
                     /gene="MEIS1"
                     /inference="alignment:Splign:1.39.8"
     variation       1414
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371372493"
     exon            1423..1481
                     /gene="MEIS1"
                     /inference="alignment:Splign:1.39.8"
     variation       1438
                     /gene="MEIS1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:146143511"
     variation       1457
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373420611"
     exon            1482..1571
                     /gene="MEIS1"
                     /inference="alignment:Splign:1.39.8"
     variation       1493
                     /gene="MEIS1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200602768"
     variation       1501
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186035658"
     variation       1527
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371528287"
     variation       1529
                     /gene="MEIS1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2901863"
     variation       1532
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144778967"
     variation       1538
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373115262"
     variation       1540
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:73937957"
     exon            1572..1667
                     /gene="MEIS1"
                     /inference="alignment:Splign:1.39.8"
     variation       1577
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373920993"
     variation       1633
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200034149"
     variation       1637
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202065303"
     variation       1650
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200965405"
     variation       1657
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:116532971"
     exon            1668..3181
                     /gene="MEIS1"
                     /inference="alignment:Splign:1.39.8"
     variation       1706
                     /gene="MEIS1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:368247164"
     variation       1757
                     /gene="MEIS1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200212828"
     variation       1882
                     /gene="MEIS1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:75905789"
     variation       1884
                     /gene="MEIS1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:77597243"
     variation       1885
                     /gene="MEIS1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:79714963"
     variation       1917
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200967798"
     variation       1944
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:76963732"
     variation       2035
                     /gene="MEIS1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371051706"
     variation       2113
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111248476"
     variation       2162
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:189086208"
     variation       2222
                     /gene="MEIS1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:140870220"
     variation       2222
                     /gene="MEIS1"
                     /replace=""
                     /replace="ta"
                     /db_xref="dbSNP:75565833"
     STS             2295..3023
                     /gene="MEIS1"
                     /standard_name="MEIS1_7825"
                     /db_xref="UniSTS:466310"
     STS             2392..2538
                     /gene="MEIS1"
                     /standard_name="Meis1"
                     /db_xref="UniSTS:143855"
     variation       2419
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149727570"
     variation       2424
                     /gene="MEIS1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:192783826"
     variation       2466
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183977225"
     variation       2537
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368947309"
     variation       2621
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188555663"
     STS             2652..2823
                     /gene="MEIS1"
                     /standard_name="NIB1519"
                     /db_xref="UniSTS:23259"
     variation       2684
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:72824830"
     variation       2699..2700
                     /gene="MEIS1"
                     /replace=""
                     /replace="cc"
                     /db_xref="dbSNP:72455806"
     variation       2776
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1058226"
     STS             2990..3116
                     /gene="MEIS1"
                     /standard_name="RH68793"
                     /db_xref="UniSTS:73800"
     variation       3013
                     /gene="MEIS1"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:34554884"
     variation       3071
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:114247424"
     variation       3072
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:181392507"
     variation       3111
                     /gene="MEIS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371273758"
     variation       3118
                     /gene="MEIS1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184386111"
     polyA_signal    3157..3162
                     /gene="MEIS1"
     polyA_site      3181
                     /gene="MEIS1"
ORIGIN

atttgaggtgttctgaccagaagaagacagagcggatgatcattcattcaccacgttgacaacctcgcctgtgattgacagctggagtggcagaaagccatgagatttggtagttgggtctgaggggcgctcttttttttccttttctttctttctttctttttttttttttaaactgatttttgggggagagaagatctgcttttttttgcccccgctgctgtcttggaaacggagcgcttttatgctcagtgactcgggcgctttgcttcaggtcccgtagaccgaagatctgggaccagtagctcacgttgctggagacgttaagggatttttcgtcgtgcttttttttttttttttttttttttccgggggagtttgaatatttgtttcttttcacactggccttaaagaggatatattagaagttgaagtaggaagggagccagagaggccgatggcgcaaaggtacgacgatctaccccattacgggggcatggatggagtaggcatcccctccacgatgtatggggacccgcatgcagccaggtccatgcagccggtccaccacctgaaccacgggcctcctctgcactcgcatcagtacccgcacacagctcataccaacgccatggcccccagcatgggctcctctgtcaatgacgctttaaagagagataaagatgccatttatggacaccccctcttccctctcttagcactgatttttgagaaatgtgaattagctacttgtaccccccgcgagccgggggtggcgggcggggacgtctgctcgtcagagtcattcaatgaagatatagccgtgttcgccaaacagattcgcgcagaaaaacctctattttcttctaatccagaactggataacttgatgattcaagccatacaagtattaaggtttcatctattggaattagagaaggtacacgaattatgtgacaatttctgccaccggtatattagctgtttgaaagggaaaatgcctatcgatttggtgatagacgatagagaaggaggatcaaaatcagacagtgaagatataacaagatcagcaaatctaactgaccagccctcttggaacagagatcatgatgacacggcatctactcgttcaggaggaaccccaggcccttccagcggtggccacacgtcacacagtggggacaacagcagtgagcaaggtgatggcttggacaacagtgtagcttcccccagcacaggtgacgatgatgaccctgataaggacaaaaagcgtcacaaaaagcgtggcatctttcccaaagtagccacaaatatcatgagggcgtggctgttccagcatctaacacacccttacccttctgaagaacagaaaaagcagttggcacaagacacgggactcaccatccttcaagtgaacaattggtttattaatgcccggagaagaatagtgcagcccatgatagaccagtccaaccgagcagtaagtcaaggaacaccttataatcctgatggacagcccatgggaggtttcgtaatggacggtcagcaacatatgggaattagagcaccaggacctatgagtggaatgggcatgaatatgggcatggaggggcagtggcactacatgtaaccttcatctagttaaccaatcgcaaagcaagggggaaggctgcaaagtatgccaggggagtatgtagcccggggtggtccaatgggtgtgagtatgggacagccaagttatacccaaccccagatgcccccccatcctgctcagctgcgtcatgggccccccatgcatacgtacattcctggacaccctcaccacccaacagtgatgatgcatggaggaccgccccaccctggaatgccaatgtcagcatcaagccccacagttcttaatacaggagacccaacaatgagtggacaagtcatggacattcatgctcagtagcttaagggaatatgcattgtctgcaatggtgactgatttcaaatcatgttttttctgcaatgactgtggagttccattcttggcatctactctggaccaaggagcatccctaattcttcatagggacctttaaaaagcaggaaataccaactgaagtcaatttgggggacatgctaaataactatataagacattaagagaacaaagagtgaaatattgtaaatgctattatactgttatccatattacgttgtttcttatagattttttaaaaaaaatgtgaaatttttccacactatgtgtgttgtttccatagctcttcacttcctccagaagcctccttacattaaaaagccttacagttatcctgcaagggacaggaaggtctgatttgcaggatttttagagcattaaaataactatcaggcagaagaatctttcttctcgcctaggatttcagccatgcgcgcgctctctctctttctctctcttttcctctctctccctctttctagcctggggcttgaatttgcatgtctaattcatttactcaccatatttgaattggcctgaacagatgtaaatcgggaaggatgggaaaaactgcagtcatcaacaatgattaatcagctgttgcaggcagtgtcttaaggagactggtaggaggaggcatggaaaccaaaaggccgtgtgtttagaagcctaattgtcacatcaagcatcattgtccccatgcaacaaccaccaccttatacatcacttcctgttttaagcagctctaaaacatagactgaagatttatttttaatatgttgactttatttctgagcaaagcatcggtcatgtgtgtattttttcatagtcccaccttggagcatttatgtagacattgtaaataaattttgtgcaaaaaggactggaaaaatgaactgtattattgcaatttttttttgtaaaagtagcagtttggtatgagttggcatgcatacaagatttactaagtgggataagctaattatactttttgttgtggataaacaaatgcttgttgatagcctttttctatcaagaaaccaaggagctaattattaataacaatcattgcacactgagtcttagcgtttctgatggaaacagtttggattgtataataacgccaagcccagttgtagtcgtttgagtgcagtaatgaaatctgaatctaaaataaaaacaagattatttttgtcaaaaaaaaaaaaaaaaaa

//

Annotations: