Home |
Help |
Advanced search
2025-05-09 19:27:35, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001937 1749 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens dermatopontin (DPT), mRNA.
ACCESSION NM_001937
VERSION NM_001937.4 GI:299758400
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1749)
AUTHORS Yamatoji,M., Kasamatsu,A., Kouzu,Y., Koike,H., Sakamoto,Y.,
Ogawara,K., Shiiba,M., Tanzawa,H. and Uzawa,K.
TITLE Dermatopontin: a potential predictor for metastasis of human oral
cancer
JOURNAL Int. J. Cancer 130 (12), 2903-2911 (2012)
PUBMED 21796630
REMARK GeneRIF: data provided strong evidence that downregulation of DPT
is a characteristic event in human oral squamous cell carcinoma and
that DPT was correlated with cellular adhesion and invasiveness.
REFERENCE 2 (bases 1 to 1749)
AUTHORS Kato,A., Okamoto,O., Ishikawa,K., Sumiyoshi,H., Matsuo,N.,
Yoshioka,H., Nomizu,M., Shimada,T. and Fujiwara,S.
TITLE Dermatopontin interacts with fibronectin, promotes fibronectin
fibril formation, and enhances cell adhesion
JOURNAL J. Biol. Chem. 286 (17), 14861-14869 (2011)
PUBMED 21398523
REMARK GeneRIF: DPT has an accelerating role in fibroblast cell adhesion
to the provisional matrix in the initial stage of wound healing.
REFERENCE 3 (bases 1 to 1749)
AUTHORS Ehret,G.B., O'Connor,A.A., Weder,A., Cooper,R.S. and Chakravarti,A.
TITLE Follow-up of a major linkage peak on chromosome 1 reveals
suggestive QTLs associated with essential hypertension: GenNet
study
JOURNAL Eur. J. Hum. Genet. 17 (12), 1650-1657 (2009)
PUBMED 19536175
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 4 (bases 1 to 1749)
AUTHORS Li,X., Feng,P., Ou,J., Luo,Z., Dai,P., Wei,D. and Zhang,C.
TITLE Dermatopontin is expressed in human liver and is downregulated in
hepatocellular carcinoma
JOURNAL Biochemistry Mosc. 74 (9), 979-985 (2009)
PUBMED 19916908
REMARK GeneRIF: suggests that dermatopontin can play various roles in
different tissues and might be a molecule related to carcinogenesis
and the progression of HCC via possible interaction with TGF-beta1
and other potential mechanisms
REFERENCE 5 (bases 1 to 1749)
AUTHORS Cheung,C.L., Chan,B.Y., Chan,V., Ikegawa,S., Kou,I., Ngai,H.,
Smith,D., Luk,K.D., Huang,Q.Y., Mori,S., Sham,P.C. and Kung,A.W.
TITLE Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible
genetic association with bone mineral density variation
JOURNAL Hum. Mol. Genet. 18 (4), 679-687 (2009)
PUBMED 19064610
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 6 (bases 1 to 1749)
AUTHORS Pochampally,R.R., Ylostalo,J., Penfornis,P., Matz,R.R., Smith,J.R.
and Prockop,D.J.
TITLE Histamine receptor H1 and dermatopontin: new downstream targets of
the vitamin D receptor
JOURNAL J. Bone Miner. Res. 22 (9), 1338-1349 (2007)
PUBMED 17547532
REMARK GeneRIF: roles of dermatopontin and histamine receptor H1 genes as
downstream targets for the VDR were confirmed by gel
electromotility shift and chromatin immunoprecipitation assays that
showed the presence of VDR complex binding sequences
REFERENCE 7 (bases 1 to 1749)
AUTHORS Kuroda,K., Okamoto,O. and Shinkai,H.
TITLE Dermatopontin expression is decreased in hypertrophic scar and
systemic sclerosis skin fibroblasts and is regulated by
transforming growth factor-beta1, interleukin-4, and matrix
collagen
JOURNAL J. Invest. Dermatol. 112 (5), 706-710 (1999)
PUBMED 10233760
REFERENCE 8 (bases 1 to 1749)
AUTHORS Okamoto,O., Fujiwara,S., Abe,M. and Sato,Y.
TITLE Dermatopontin interacts with transforming growth factor beta and
enhances its biological activity
JOURNAL Biochem. J. 337 (PT 3), 537-541 (1999)
PUBMED 9895299
REFERENCE 9 (bases 1 to 1749)
AUTHORS Forbes,E.G., Cronshaw,A.D., MacBeath,J.R. and Hulmes,D.J.
TITLE Tyrosine-rich acidic matrix protein (TRAMP) is a tyrosine-sulphated
and widely distributed protein of the extracellular matrix
JOURNAL FEBS Lett. 351 (3), 433-436 (1994)
PUBMED 8082810
REFERENCE 10 (bases 1 to 1749)
AUTHORS Superti-Furga,A., Rocchi,M., Schafer,B.W. and Gitzelmann,R.
TITLE Complementary DNA sequence and chromosomal mapping of a human
proteoglycan-binding cell-adhesion protein (dermatopontin)
JOURNAL Genomics 17 (2), 463-467 (1993)
PUBMED 8104875
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
BP257325.1, BC033736.1 and AI699890.1.
On Jun 26, 2010 this sequence version replaced gi:32307171.
Summary: Dermatopontin is an extracellular matrix protein with
possible functions in cell-matrix interactions and matrix assembly.
The protein is found in various tissues and many of its tyrosine
residues are sulphated. Dermatopontin is postulated to modify the
behavior of TGF-beta through interaction with decorin. [provided by
RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: CD685387.1, BC033736.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025083 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-564 BP257325.1 1-564
565-1717 BC033736.1 551-1703
1718-1749 AI699890.1 1-32 c
FEATURES Location/Qualifiers
source 1..1749
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1q12-q23"
gene 1..1749
/gene="DPT"
/gene_synonym="TRAMP"
/note="dermatopontin"
/db_xref="GeneID:1805"
/db_xref="HGNC:3011"
/db_xref="HPRD:00510"
/db_xref="MIM:125597"
exon 1..335
/gene="DPT"
/gene_synonym="TRAMP"
/inference="alignment:Splign:1.39.8"
CDS 31..636
/gene="DPT"
/gene_synonym="TRAMP"
/note="tyrosine-rich acidic matrix protein"
/codon_start=1
/product="dermatopontin precursor"
/protein_id="NP_001928.2"
/db_xref="GI:32307172"
/db_xref="CCDS:CCDS1275.1"
/db_xref="GeneID:1805"
/db_xref="HGNC:3011"
/db_xref="HPRD:00510"
/db_xref="MIM:125597"
/translation="
MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV
"
sig_peptide 31..84
/gene="DPT"
/gene_synonym="TRAMP"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
mat_peptide 85..633
/gene="DPT"
/gene_synonym="TRAMP"
/product="Dermatopontin"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q07507.2)"
misc_feature 85..87
/gene="DPT"
/gene_synonym="TRAMP"
/inference="non-experimental evidence, no additional
details recorded"
/note="(By similarity); propagated from
UniProtKB/Swiss-Prot (Q07507.2); other site"
misc_feature 106..588
/gene="DPT"
/gene_synonym="TRAMP"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q07507.2);
Region: 2 X 53-55 AA tandem repeats"
misc_feature 238..588
/gene="DPT"
/gene_synonym="TRAMP"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q07507.2);
Region: 3 X 6 AA repeats of D-R-[EQ]-W-[NQK]-[FY]"
variation 145
/gene="DPT"
/gene_synonym="TRAMP"
/replace="a"
/replace="g"
/db_xref="dbSNP:998688"
variation 270
/gene="DPT"
/gene_synonym="TRAMP"
/replace="a"
/replace="g"
/db_xref="dbSNP:1052591"
variation 307
/gene="DPT"
/gene_synonym="TRAMP"
/replace="g"
/replace="t"
/db_xref="dbSNP:998689"
exon 336..461
/gene="DPT"
/gene_synonym="TRAMP"
/inference="alignment:Splign:1.39.8"
variation 385
/gene="DPT"
/gene_synonym="TRAMP"
/replace="a"
/replace="t"
/db_xref="dbSNP:11551958"
variation 434
/gene="DPT"
/gene_synonym="TRAMP"
/replace="a"
/replace="t"
/db_xref="dbSNP:14395"
exon 462..569
/gene="DPT"
/gene_synonym="TRAMP"
/inference="alignment:Splign:1.39.8"
variation 470
/gene="DPT"
/gene_synonym="TRAMP"
/replace="c"
/replace="t"
/db_xref="dbSNP:11551959"
exon 570..1728
/gene="DPT"
/gene_synonym="TRAMP"
/inference="alignment:Splign:1.39.8"
STS 588..786
/gene="DPT"
/gene_synonym="TRAMP"
/standard_name="RH36563"
/db_xref="UniSTS:31366"
STS 1487..1614
/gene="DPT"
/gene_synonym="TRAMP"
/standard_name="RH103231"
/db_xref="UniSTS:97563"
STS 1496..1668
/gene="DPT"
/gene_synonym="TRAMP"
/standard_name="SHGC-75872"
/db_xref="UniSTS:80307"
ORIGIN
gtgacattgtttgccaaaatcccaggcagcatggacctcagtcttctctgggtacttctgcccctagtcaccatggcctggggccagtatggcgattatggatacccataccagcagtatcatgactacagcgatgatgggtgggtgaatttgaaccggcaaggcttcagctaccagtgtccccaggggcaggtgatagtggccgtgaggagcatcttcagcaagaaggaaggttctgacagacaatggaactacgcctgcatgcccacgccacagagcctcggggaacccacggagtgctggtgggaggagatcaacagggctggcatggaatggtaccagacgtgctccaacaatgggctggtggcaggattccagagccgctacttcgagtcagtgctggatcgggagtggcagttttactgttgtcgctacagcaagaggtgcccatattcctgctggctaacaacagaatatccaggtcactatggtgaggaaatggacatgatttcctacaattatgattactatatccgaggagcaacaaccactttctctgcagtggaaagggatcgccagtggaagttcataatgtgccggatgactgaatacgactgtgaatttgcaaatgtttagatttgccacataccaaatctgggtgaaaggaaaggggccggggacaggagggtgtccacatatgttaacatcagttggatctcctatagaagtttctgctgctctctttccttctccctgagctggtaactgcaatgccaacttcctgggcctttctgactagtatcacacttctaataaaatccacaattaaaccatgtttctcacttttcacatgtttcatagcaactgctttatatgactgatgatggcttccttgcacaccacatatacagtgcgcatgcttacagccgggcttctggagcaccagctgcagcctggctactgctttttactgcagaatgaactgcaagttcagcatagtggaggggagaggcagaactggaggagaggtgcagtgaaggttctctacagctaagcctgtttgaatgatacgtaggttccccaccaaaagcaggctttctgccctgagggacatcttcccactcccctgctccacatgagccatgcatgcttagcaatccaagtgcagagctctttgctccaggagtgaggagactgggaggtgaaatggggaaatggaagggtttggaggcagagctgaaaacagggttggaaggatttcctgaattagaagacaaacgttagcatacccagtaaggaaaatgagtgcaggggccaggggaacccgtgaggatcactctcaaatgagattaaaaacaaggaagcagagaatggtcagagaatgggattcagattgggaacttgtggggatgagagtgaccaggttgaactgggaagtggaaaaaggagtttgagtcactggcacctagaagcctgcccacgattcctaggaaggctggcagacaccctggaaccctggggagctactggcaaactctcctggattgggcctgatttttttggtgggaaaggctgccctggggatcaactttccttctgtgtgtggctcaggagttcttctgcagagatggcgctatctttcctcctcctgtgatgtcctgctcccaaccatttgtactcttcattacaaaagaaataaaaatattaacgttcactatgctgaaaataaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:1805 -> Biological process: GO:0007155 [cell adhesion] evidence: IEA
GeneID:1805 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: IEA
GeneID:1805 -> Biological process: GO:0030199 [collagen fibril organization] evidence: IEA
GeneID:1805 -> Cellular component: GO:0005578 [proteinaceous extracellular matrix] evidence: IEA
GeneID:1805 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA
GeneID:1805 -> Cellular component: GO:0031012 [extracellular matrix] evidence: IDA
GeneID:1805 -> Cellular component: GO:0031012 [extracellular matrix] evidence: ISS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.