GGRNA Home | Help | Advanced search

2025-05-09 20:37:37, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001220482            3123 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens Meis homeobox 2 (MEIS2), transcript variant i, mRNA.
ACCESSION   NM_001220482
VERSION     NM_001220482.1  GI:333805647
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3123)
  AUTHORS   Bjerke,G.A., Hyman-Walsh,C. and Wotton,D.
  TITLE     Cooperative transcriptional activation by Klf4, Meis2, and Pbx1
  JOURNAL   Mol. Cell. Biol. 31 (18), 3723-3733 (2011)
   PUBMED   21746878
  REMARK    GeneRIF: Klf4 recruits a complex of Meis and Pbx proteins to DNA,
            resulting in Meis2 transcriptional activation domain-dependent
            activation of a subset of Klf4 target genes.
REFERENCE   2  (bases 1 to 3123)
  AUTHORS   Shibata,M., Nakao,H., Kiyonari,H., Abe,T. and Aizawa,S.
  TITLE     MicroRNA-9 regulates neurogenesis in mouse telencephalon by
            targeting multiple transcription factors
  JOURNAL   J. Neurosci. 31 (9), 3407-3422 (2011)
   PUBMED   21368052
  REMARK    GeneRIF: Transgenic mice lacking microRNAs miR-9-2 and miR-9-3
            exhibit multiple defects of telencephalic structures which may be
            brought about by dysregulation of Foxg1, Nr2e1, Gsh2, and Meis2
            expression.
REFERENCE   3  (bases 1 to 3123)
  AUTHORS   Adkins,D.E., Aberg,K., McClay,J.L., Bukszar,J., Zhao,Z., Jia,P.,
            Stroup,T.S., Perkins,D., McEvoy,J.P., Lieberman,J.A., Sullivan,P.F.
            and van den Oord,E.J.
  TITLE     Genomewide pharmacogenomic study of metabolic side effects to
            antipsychotic drugs
  JOURNAL   Mol. Psychiatry 16 (3), 321-332 (2011)
   PUBMED   20195266
  REMARK    GeneRIF: The Single Nucleotide Polymorphism in Meis homeobox 2
            (MEIS2) mediated the effects of risperidone on hip circumference
            (q=0.004).
            GeneRIF: Clinical trial and genome-wide association study of
            gene-disease association. (HuGE Navigator)
REFERENCE   4  (bases 1 to 3123)
  AUTHORS   Larsen,K.B., Lutterodt,M.C., Laursen,H., Graem,N., Pakkenberg,B.,
            Mollgard,K. and Moller,M.
  TITLE     Spatiotemporal distribution of PAX6 and MEIS2 expression and total
            cell numbers in the ganglionic eminence in the early developing
            human forebrain
  JOURNAL   Dev. Neurosci. 32 (2), 149-162 (2010)
   PUBMED   20523026
  REMARK    GeneRIF: Data demonstrate by in situ hybridization and
            immunohistochemistry that the two homeobox genes Pax6 and MEIS2 are
            expressed during early fetal brain development in humans.
REFERENCE   5  (bases 1 to 3123)
  AUTHORS   Hyman-Walsh,C., Bjerke,G.A. and Wotton,D.
  TITLE     An autoinhibitory effect of the homothorax domain of Meis2
  JOURNAL   FEBS J. 277 (12), 2584-2597 (2010)
   PUBMED   20553494
  REMARK    GeneRIF: This work suggests that the transcriptional activity of
            all members of the Meis/Prep Hth protein family is subject to
            autoinhibition by their Hth domains, and that the Meis3.2 splice
            variant encodes a protein that bypasses this autoinhibitory effect.
REFERENCE   6  (bases 1 to 3123)
  AUTHORS   Fujino,T., Yamazaki,Y., Largaespada,D.A., Jenkins,N.A.,
            Copeland,N.G., Hirokawa,K. and Nakamura,T.
  TITLE     Inhibition of myeloid differentiation by Hoxa9, Hoxb8, and Meis
            homeobox genes
  JOURNAL   Exp. Hematol. 29 (7), 856-863 (2001)
   PUBMED   11438208
REFERENCE   7  (bases 1 to 3123)
  AUTHORS   Liu,Y., MacDonald,R.J. and Swift,G.H.
  TITLE     DNA binding and transcriptional activation by a PDX1.PBX1b.MEIS2b
            trimer and cooperation with a pancreas-specific basic
            helix-loop-helix complex
  JOURNAL   J. Biol. Chem. 276 (21), 17985-17993 (2001)
   PUBMED   11279116
REFERENCE   8  (bases 1 to 3123)
  AUTHORS   Yang,Y., Hwang,C.K., D'Souza,U.M., Lee,S.H., Junn,E. and
            Mouradian,M.M.
  TITLE     Three-amino acid extension loop homeodomain proteins Meis2 and TGIF
            differentially regulate transcription
  JOURNAL   J. Biol. Chem. 275 (27), 20734-20741 (2000)
   PUBMED   10764806
REFERENCE   9  (bases 1 to 3123)
  AUTHORS   Smith,J.E., Afonja,O., Yee,H.T., Inghirami,G. and Takeshita,K.
  TITLE     Chromosomal mapping to 15q14 and expression analysis of the human
            MEIS2 homeobox gene
  JOURNAL   Mamm. Genome 8 (12), 951-952 (1997)
   PUBMED   9383298
REFERENCE   10 (bases 1 to 3123)
  AUTHORS   Steelman,S., Moskow,J.J., Muzynski,K., North,C., Druck,T.,
            Montgomery,J.C., Huebner,K., Daar,I.O. and Buchberg,A.M.
  TITLE     Identification of a conserved family of Meis1-related homeobox
            genes
  JOURNAL   Genome Res. 7 (2), 142-156 (1997)
   PUBMED   9049632
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AK300247.1, BC050431.1,
            AC078909.7, AK226072.1 and BM679305.1.
            
            Summary: This gene encodes a homeobox protein belonging to the TALE
            ('three amino acid loop extension') family of
            homeodomain-containing proteins. TALE homeobox proteins are highly
            conserved transcription regulators, and several members have been
            shown to be essential contributors to developmental programs.
            Multiple transcript variants encoding distinct isoforms have been
            described for this gene. [provided by RefSeq, Jul 2008].
            
            Transcript Variant: This variant (i) differs in the 5' UTR, lacks
            the coding exon containing the stop codon, and uses an alternate
            in-frame splice junction at the 5' end of an exon compared to
            variant a. The resulting isoform (d) has a longer and distinct
            C-terminus and lacks an alternate in-frame segment compared to
            isoform a. Variants d and i both encode the same isoform (d).
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC050431.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025081, ERS025082 [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-119               AK300247.1         23-141
            120-455             BC050431.1         1-336
            456-456             AC078909.7         67899-67899
            457-3053            BC050431.1         337-2933
            3054-3101           AK226072.1         3307-3354
            3102-3123           BM679305.1         1-22                c
FEATURES             Location/Qualifiers
     source          1..3123
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="15"
                     /map="15q14"
     gene            1..3123
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /note="Meis homeobox 2"
                     /db_xref="GeneID:4212"
                     /db_xref="HGNC:7001"
                     /db_xref="MIM:601740"
     exon            1..408
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3110012"
     variation       complement(149)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143532159"
     variation       complement(329..330)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:34332784"
     variation       complement(357)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376028608"
     exon            409..553
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(410)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112410187"
     variation       complement(456)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:111602525"
     misc_feature    500..502
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /note="upstream in-frame stop codon"
     variation       complement(509)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201918475"
     variation       complement(512)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199649371"
     CDS             542..1954
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /note="isoform d is encoded by transcript variant i; Meis
                     homolog 2; TALE homeobox protein Meis2; Meis1-related gene
                     1; meis1-related protein 1; Meis1, myeloid ecotropic viral
                     integration site 1 homolog 2"
                     /codon_start=1
                     /product="homeobox protein Meis2 isoform d"
                     /protein_id="NP_001207411.1"
                     /db_xref="GI:333805648"
                     /db_xref="CCDS:CCDS10045.1"
                     /db_xref="GeneID:4212"
                     /db_xref="HGNC:7001"
                     /db_xref="MIM:601740"
                     /translation="
MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMSMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ
"
     misc_feature    752..1114
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O14770.2);
                     Region: Required for interaction with PBX1 (By
                     similarity)"
     misc_feature    1379..1540
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(1379..1384,1388..1390,1448..1450,1466..1468,
                     1505..1507,1511..1516,1523..1528,1532..1540)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(1385..1387,1514..1516,1523..1528,1535..1537)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     exon            554..786
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(565)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369672617"
     variation       complement(631)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:376901048"
     variation       complement(643)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200799360"
     variation       complement(644)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138503850"
     variation       complement(661)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144628203"
     variation       complement(691)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375301418"
     variation       complement(694)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140890748"
     variation       complement(708)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372646327"
     exon            787..928
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /inference="alignment:Splign:1.39.8"
     STS             788..1650
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /standard_name="Mrg1"
                     /db_xref="UniSTS:507072"
     variation       complement(870..871)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace=""
                     /replace="ggggggggg"
                     /db_xref="dbSNP:138513608"
     exon            929..979
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(941)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200496429"
     exon            980..1030
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1012)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:137952617"
     exon            1031..1180
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1048)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139184400"
     variation       complement(1067)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368930165"
     variation       complement(1081)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149182994"
     variation       complement(1120)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377204162"
     variation       complement(1148)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:185278462"
     variation       complement(1156)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:145358549"
     variation       complement(1159)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150470779"
     variation       complement(1171)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141907934"
     exon            1181..1295
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1223)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147874392"
     variation       complement(1273)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61734550"
     variation       complement(1274)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375357305"
     variation       complement(1283)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376747133"
     variation       complement(1291)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370758497"
     exon            1296..1441
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1350)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369609025"
     variation       complement(1351)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183075611"
     exon            1442..1518
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1480)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140793410"
     exon            1519..1577
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1571)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:367563077"
     exon            1578..1667
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /inference="alignment:Splign:1.39.8"
     exon            1668..3106
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1694)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151055354"
     variation       complement(1701)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142878520"
     variation       complement(1734)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113747758"
     variation       complement(1753)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:57860578"
     variation       complement(1774)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148444214"
     variation       complement(1782)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144548752"
     variation       complement(1783)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199728455"
     variation       complement(1829)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374458760"
     variation       complement(1832)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141054432"
     variation       complement(1834)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200282136"
     variation       complement(1843)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139991974"
     variation       complement(1844)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201588285"
     variation       complement(1861)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:145933742"
     variation       complement(1863)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370135711"
     variation       complement(1872)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142325445"
     variation       complement(1874)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377210457"
     variation       complement(1885)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372766056"
     variation       complement(1935)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150313361"
     variation       complement(1947)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369601092"
     variation       complement(1986)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:77635771"
     variation       complement(2023)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:146614487"
     variation       complement(2208)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:144383417"
     variation       complement(2292)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:139647839"
     variation       complement(2368..2369)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:34412514"
     variation       complement(2380)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:72708659"
     variation       complement(2406)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:117434306"
     variation       complement(2430..2431)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:34654533"
     variation       complement(2442..2443)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:35427488"
     variation       complement(2576)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:146332496"
     variation       complement(2616)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373295254"
     variation       complement(2670)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369432376"
     variation       complement(2694)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:376202599"
     variation       complement(2718)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:34362471"
     variation       complement(2881)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:375754667"
     STS             2896..3074
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /db_xref="UniSTS:34756"
     variation       complement(3043..3044)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace=""
                     /replace="aa"
                     /db_xref="dbSNP:79470888"
     variation       complement(3053)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:34976538"
     variation       complement(3053)
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200863215"
     polyA_signal    3077..3082
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
     polyA_site      3106
                     /gene="MEIS2"
                     /gene_synonym="HsT18361; MRG1"
ORIGIN      
ttggctacatcggacccagatgactgcctcctcacttcctccctcccgattccgccgcggcccccaaagactctcggggtggccccttgtccgcaccgcttggagggagtgtgctctgagttaagctggtctcttctggtcctggaaaaaaatgagtattgacaaggttgctggatctgcgcagaaaagaaagtgccacttaataaaaaatttagcccggcagtggtaccgtctgcagagcttgctgcccttggacgttagcaggaagccttcggggtgctgtaatcggcgggcagaggagagggaggccgcggaattaaaaggaacaaaagctagagcgccatgccaaacgtccccggcaagacccagttaggcaggagccgggagtgatgggaaaatgaactagaacatattggagaattgggagaagtctctttggtttggaaaaaaaaaaaaggaatcttcagcctagatcactttcttatccggactgggatattaaatatacgacacatccaggagtttattggagcgcagactgatggcgcaaaggtacgatgagctgccccattacggcgggatggacggagtaggggttcccgcttccatgtacggagaccctcacgcgccgcggccgatccccccggttcaccacctgaaccacgggccgccgctccacgccacacagcactacggcgcgcacgccccgcaccccaatgtcatgccggccagtatgggatccgctgtcaacgacgccttgaagcgggacaaggacgcgatctatgggcacccgttgtttcctctgttagctctggtctttgagaagtgcgagctggcgacctgcactccccgggaacctggagtggctggcggagacgtctgctcctccgactccttcaacgaggacatcgcggtcttcgccaagcaggttcgcgccgaaaagccacttttttcctcaaatccagagctggacaatttgatgatacaagcaatacaagtactaaggtttcatcttttggagttagaaaaggtccacgaactgtgcgataacttctgccaccgatacattagctgtttgaaggggaaaatgcccatcgacctcgtcattgatgaaagagacggcagctccaagtcagatcatgaagaactttcaggctcctccacaaatctcgctgaccataacccttcttcttggcgagaccacgatgatgcaacctcaacccactcagcaggcaccccagggccctccagtgggggccatgcttcccagagcggagacaacagcagtgagcaaggggatggtttagacaacagtgtagcttcacctggtacaggtgacgatgatgatccggataaggacaaaaaacgccagaagaaaagaggcattttccccaaagtagcaacaaatatcatgagagcatggctcttccagcatctcacacatccgtacccttccgaagagcagaagaaacagttagcgcaagacacaggacttacaattctccaagtaaacaactggtttattaatgccagaagaagaatagtacagcccatgattgaccagtcaaatcgagcagtgagccaaggagcagcatatagtccagagggtcagcccatggggagctttgtgttggatggtcagcaacacatggggatccggcctgcaggtttgcagagcatgccaggggactacgtttctcagggtggtcctatgggaatgagtatggcacagccaagttacactcctccccagatgaccccacaccctactcaattaagacatggacccccaatgcattcatatttgccaagccatccccaccacccagccatgatgatgcacggaggaccccctacccaccctggaatgactatgtcagcacagagccccacaatgttaaattctgtagatcccaatgttggcggacaggttatggacattcatgcccaatagtataagggaactcaagggaaaaggaaacacacgcaaaaactattttaagactttctgaactttgaccagatgttgacacttaatatgaaattccagacagctgtgattattttttacttttgtcatttttcatcaagcaacagaggaccaatgcaacaagaacacaaatgtgaaatcatgggctgactgagacaattctgtccatgtaaagatcctctggaaaaagactccgagagttataactactgtagtataaatataggaactaagttaaacttgtacatttctgttgatcacgccgttatgttgcctcaaatagttttagaagagaaaaaaaaatatatccttgttttccacactatgtgtgttgttcccaaaagaatgactgttttggttcatcagtgaattcaccatccaggagagactgtggtatatattttaaacctgttgggccaatgagaaaagaaccacactggagatcatgatgaacttttggctgaacctcatcactcgaactccagcttcaagaatgtgttttcatgcccggcctttgttcctccataaatgtgtcctttagtttcaaacagatctttatagttcgtgcttcataagccaattcttattattatttttgggggactcttcttcaaagagcttgccaatgaagatttaaagacagagcaggagcttcttccaggagttctgagccttggttgtggacaaaacaatcttaagttgggcagctttcctcaacacaaaaaaaagttattaatggtcattgaaccataactaggactttatcagaaactcaaagcttgggggataaaaaggagcaagagaatactgtaacaaacttcgtacagagttcggtctattaattgtttcatgttagatattctatgtgtttacctcaattgaaaaaaaaaagaatgtttttgctagtatcagatctgctgtggaattggtattgtatgtccatgaattcttcttttctcagcacgtgttcctcactagaagaaaatgctgttacctttaagctttgtcaaatttacattaaaatacttgtatgaggactgtgacgttatgttaaaaaaaaaaaggtgttaagtcacaaaaagcggtaataaatatttcatttttgattttttgttaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:4212 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:4212 -> Molecular function: GO:0003712 [transcription cofactor activity] evidence: ISS
            GeneID:4212 -> Molecular function: GO:0003714 [transcription corepressor activity] evidence: TAS
            GeneID:4212 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:4212 -> Molecular function: GO:0008134 [transcription factor binding] evidence: ISS
            GeneID:4212 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IDA
            GeneID:4212 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:4212 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: TAS
            GeneID:4212 -> Biological process: GO:0001654 [eye development] evidence: IEA
            GeneID:4212 -> Biological process: GO:0006366 [transcription from RNA polymerase II promoter] evidence: TAS
            GeneID:4212 -> Biological process: GO:0045638 [negative regulation of myeloid cell differentiation] evidence: ISS
            GeneID:4212 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IEA
            GeneID:4212 -> Cellular component: GO:0005634 [nucleus] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.