GGRNA Home | Help | Advanced search

2025-05-09 20:30:50, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001205296            1780 bp    mRNA    linear   PRI 16-JUN-2013
DEFINITION  Homo sapiens transcription termination factor, RNA polymerase I
            (TTF1), transcript variant 2, mRNA.
ACCESSION   NM_001205296
VERSION     NM_001205296.1  GI:328927004
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1780)
  AUTHORS   Sakaeda,M., Sato,H., Ishii,J., Miyata,C., Kamma,H.,
            Shishido-Hara,Y., Shimoyamada,H., Fujiwara,M., Endo,T., Tanaka,R.,
            Kondo,H., Goya,T., Aoki,I. and Yazawa,T.
  TITLE     Neural lineage-specific homeoprotein BRN2 is directly involved in
            TTF1 expression in small-cell lung cancer
  JOURNAL   Lab. Invest. 93 (4), 408-421 (2013)
   PUBMED   23358112
  REMARK    GeneRIF: TTF1 expression in small-cell lung cancer is a cell
            lineage-specific phenomenon that involves the developing neural
            cell-specific homeoprotein BRN2.
REFERENCE   2  (bases 1 to 1780)
  AUTHORS   Denby,K.S., Briones,A.J., Bourne,P.A., Spaulding,B.O., Lu,D.,
            Fischer-Colbrie,R., Qu,Z., Wang,H.L. and Xu,H.
  TITLE     IMP3, NESP55, TTF-1 and CDX2 serve as an immunohistochemical panel
            in the distinction among small-cell carcinoma, gastrointestinal
            carcinoid, and pancreatic endocrine tumor metastasized to the liver
  JOURNAL   Appl. Immunohistochem. Mol. Morphol. 20 (6), 573-579 (2012)
   PUBMED   22495359
  REMARK    GeneRIF: All 16 metastatic PETs were positively stained for IMP3
            with 12 cases (75%) showing a diffuse and moderate-to-strong
            staining pattern while they were negative for TTF-1
REFERENCE   3  (bases 1 to 1780)
  AUTHORS   Zu,Y.F., Wang,X.C., Chen,Y., Wang,J.Y., Liu,X., Li,X., Li,C.W.,
            Xie,Y.C., Luo,Y., Shang,X.Q. and Guo,J.
  TITLE     Thyroid transcription factor 1 represses the expression of Ki-67
            and induces apoptosis in non-small cell lung cancer
  JOURNAL   Oncol. Rep. 28 (5), 1544-1550 (2012)
   PUBMED   22940844
  REMARK    GeneRIF: TTF-1 may serve as a tumor suppressor gene based on its
            inverse correlation with Ki-67 proliferative activity and increase
            of cellular apoptosis
REFERENCE   4  (bases 1 to 1780)
  AUTHORS   Sullivan,P.S., Maresh,E.L., Seligson,D.B., Habeeb,O., Wadehra,M.,
            Goodglick,L. and Dorigo,O.
  TITLE     Expression of thyroid transcription factor-1 in normal endometrium
            is associated with risk of endometrial cancer development
  JOURNAL   Mod. Pathol. 25 (8), 1140-1148 (2012)
   PUBMED   22460811
  REMARK    GeneRIF: TTF-1 expression in normal endometrium is associated with
            a reduced risk of endo-metrial cancer development.
REFERENCE   5  (bases 1 to 1780)
  AUTHORS   Sun,P.L., Seol,H., Lee,H.J., Yoo,S.B., Kim,H., Xu,X., Jheon,S.,
            Lee,C.T., Lee,J.S. and Chung,J.H.
  TITLE     High incidence of EGFR mutations in Korean men smokers with no
            intratumoral heterogeneity of lung adenocarcinomas: correlation
            with histologic subtypes, EGFR/TTF-1 expressions, and clinical
            features
  JOURNAL   J Thorac Oncol 7 (2), 323-330 (2012)
   PUBMED   22237264
  REMARK    GeneRIF: High TTF-1 expression is associated with smoking and lung
            adenocarcinoma histology
REFERENCE   6  (bases 1 to 1780)
  AUTHORS   Yoon,S.O., Kim,Y.T., Jung,K.C., Jeon,Y.K., Kim,B.H. and Kim,C.W.
  TITLE     TTF-1 mRNA-positive circulating tumor cells in the peripheral blood
            predict poor prognosis in surgically resected non-small cell lung
            cancer patients
  JOURNAL   Lung Cancer 71 (2), 209-216 (2011)
   PUBMED   20471712
  REMARK    GeneRIF: TTF-1 mRNA-expressing CTCs might be a useful surrogate
            predictor of disease progression for non-small cell lung cancer
            (NSCLC) patients before clinical manifestations are apparent.
REFERENCE   7  (bases 1 to 1780)
  AUTHORS   Lessard,F., Morin,F., Ivanchuk,S., Langlois,F., Stefanovsky,V.,
            Rutka,J. and Moss,T.
  TITLE     The ARF tumor suppressor controls ribosome biogenesis by regulating
            the RNA polymerase I transcription factor TTF-I
  JOURNAL   Mol. Cell 38 (4), 539-550 (2010)
   PUBMED   20513429
  REMARK    GeneRIF: Depletion of TTF-I recapitulates the effects of ARF on
            ribosomal RNA synthesis and is rescued by the introduction of a
            TTF-I transgene.
REFERENCE   8  (bases 1 to 1780)
  AUTHORS   Richard,P. and Manley,J.L.
  TITLE     Transcription termination by nuclear RNA polymerases
  JOURNAL   Genes Dev. 23 (11), 1247-1269 (2009)
   PUBMED   19487567
REFERENCE   9  (bases 1 to 1780)
  AUTHORS   Sirri,V., Roussel,P. and Hernandez-Verdun,D.
  TITLE     The mitotically phosphorylated form of the transcription
            termination factor TTF-1 is associated with the repressed rDNA
            transcription machinery
  JOURNAL   J. Cell. Sci. 112 (PT 19), 3259-3268 (1999)
   PUBMED   10504331
REFERENCE   10 (bases 1 to 1780)
  AUTHORS   Evers,R. and Grummt,I.
  TITLE     Molecular coevolution of mammalian ribosomal gene terminator
            sequences and the transcription termination factor TTF-I
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 92 (13), 5827-5831 (1995)
   PUBMED   7597036
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BP209178.1, BC127670.1 and
            AL353701.15.
            
            Summary: This gene encodes a transcription termination factor that
            is localized to the nucleolus and plays a critical role in
            ribosomal gene transcription. The encoded protein mediates the
            termination of RNA polymerase I transcription by binding to Sal box
            terminator elements downstream of pre-rRNA coding regions.
            Alternatively spliced transcript variants encoding multiple
            isoforms have been observed for this gene. This gene shares the
            symbol/alias 'TFF1' with another gene, NK2 homeobox 1, also known
            as thyroid transcription factor 1, which plays a role in the
            regulation of thyroid-specific gene expression. [provided by
            RefSeq, Apr 2011].
            
            Transcript Variant: This variant (2) lacks an exon in the 5' coding
            region and initiates translation at a downstream, in-frame start
            codon, compared to variant 1. The encoded isoform (2) has a shorter
            N-terminus, compared to isoform 1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC127669.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025088 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-25                BP209178.1         1-25
            26-959              BC127670.1         1-934
            960-960             AL353701.15        69299-69299         c
            961-1473            BC127670.1         936-1448
            1474-1780           AL353701.15        56661-56967         c
FEATURES             Location/Qualifiers
     source          1..1780
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="9"
                     /map="9q34.13"
     gene            1..1780
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /note="transcription termination factor, RNA polymerase I"
                     /db_xref="GeneID:7270"
                     /db_xref="HGNC:12397"
                     /db_xref="MIM:600777"
     exon            1..62
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(11)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138223705"
     STS             28..1501
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /db_xref="UniSTS:494645"
     variation       complement(41)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:112958498"
     variation       complement(48)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:183522856"
     variation       complement(51)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571856"
     exon            63..286
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(85)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374464106"
     variation       complement(90)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:148256256"
     variation       complement(111)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144643349"
     variation       complement(112)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12336746"
     variation       complement(116)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144158263"
     variation       complement(119)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370944949"
     variation       complement(124)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111735033"
     variation       complement(147)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199954975"
     variation       complement(148)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377409657"
     variation       complement(178)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145243204"
     variation       complement(192)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148836459"
     variation       complement(224)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:145860666"
     CDS             241..1413
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /note="isoform 2 is encoded by transcript variant 2;
                     transcription termination factor 1"
                     /codon_start=1
                     /product="transcription termination factor 1 isoform 2"
                     /protein_id="NP_001192225.1"
                     /db_xref="GI:328927005"
                     /db_xref="GeneID:7270"
                     /db_xref="HGNC:12397"
                     /db_xref="MIM:600777"
                     /translation="
MYRDDLERFKEFKAQGVAIKFGKFSVKENKQLEKNVEDFLALTGIESADKLLYTDRYPEEKSVITNLKRRYSFRLHIGRNIARPWKLIYYRAKKMFDVNNYKGRYSEGDTEKLKMYHSLLGNDWKTIGEMVARSSLSVALKFSQISSQRNRGAWSKSETRKLIKAVEEVILKKMSPQELKEVDSKLQENPESCLSIVREKLYKGISWVEVEAKVQTRNWMQCKSKWTEILTKRMTNGRRIYYGMNALRAKVSLIERLYEINVEDTNEIDWEDLASAIGDVPPSYVQTKFSRLKAVYVPFWQKKTFPEIIDYLYETTLPLLKEKLEKMMEKKGTKIQTPAAPKQVFPFRDIFYYEDDSEGEDIEKESEGQAPCMAHACNSSTLGGQGRWII
"
     misc_feature    553..726
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /note="Myb-like DNA-binding domain; Region:
                     Myb_DNA-bind_6; pfam13921"
                     /db_xref="CDD:206092"
     exon            287..472
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(308)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149860709"
     variation       complement(311)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141031290"
     variation       complement(317)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147725500"
     variation       complement(361)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:145414490"
     variation       complement(372)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139989523"
     variation       complement(373)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368358602"
     variation       complement(377)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147864317"
     variation       complement(393)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:504525"
     variation       complement(399)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148728567"
     variation       complement(401)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376566399"
     variation       complement(403)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:61746239"
     variation       complement(456)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201529682"
     variation       complement(461)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:189822915"
     exon            473..551
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(499)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200329159"
     variation       complement(503)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149329370"
     variation       complement(512)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199515529"
     variation       complement(528)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371348195"
     variation       complement(529)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139550431"
     exon            552..682
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(558)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184375956"
     variation       complement(559)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373368136"
     STS             601..681
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /standard_name="D9S1005E"
                     /db_xref="UniSTS:151253"
     variation       complement(618)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370191696"
     variation       complement(620)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141877247"
     variation       complement(652)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200692968"
     variation       complement(660)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201285903"
     exon            683..917
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(691)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199931383"
     variation       complement(718)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374966991"
     variation       complement(719)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372187072"
     variation       complement(738)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368907058"
     variation       complement(739)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146001980"
     variation       complement(771)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:57883923"
     variation       complement(823)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374150357"
     variation       complement(826)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199597483"
     variation       complement(833)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371238626"
     variation       complement(868)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192765473"
     variation       complement(888)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148882175"
     variation       complement(902)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371664876"
     exon            918..1007
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(960)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:556386"
     variation       complement(982)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112758716"
     variation       complement(983)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370531581"
     variation       complement(992)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200634710"
     exon            1008..1073
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1013)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373530334"
     variation       complement(1024)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141141589"
     variation       complement(1069)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369763860"
     exon            1074..1159
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1079)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148200795"
     variation       complement(1081)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371815734"
     variation       complement(1092)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200153166"
     variation       complement(1093)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185996276"
     exon            1160..1780
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1184)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376708794"
     variation       complement(1187)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372447641"
     variation       complement(1204)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368286256"
     variation       complement(1256)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:143380146"
     variation       complement(1263)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149222849"
     variation       complement(1305)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201618724"
     variation       complement(1325)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147709121"
     variation       complement(1333)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace=""
                     /replace="aaag"
                     /db_xref="dbSNP:79799462"
     variation       complement(1338)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147089074"
     variation       complement(1349)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1752676"
     variation       complement(1350)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111275070"
     variation       complement(1355)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201815658"
     variation       complement(1365)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199752397"
     variation       complement(1379)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187685855"
     variation       complement(1394)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112611962"
     variation       complement(1400)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147901566"
     variation       complement(1417)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:371763808"
     STS             1421..1548
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /standard_name="D15S1477"
                     /db_xref="UniSTS:474482"
     variation       complement(1425)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367633316"
     variation       complement(1474)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1752675"
     variation       complement(1549)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111878239"
     variation       complement(1606..1607)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace=""
                     /replace="ga"
                     /db_xref="dbSNP:139464117"
     STS             1617..1740
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /standard_name="RH65956"
                     /db_xref="UniSTS:82732"
     variation       complement(1700)
                     /gene="TTF1"
                     /gene_synonym="TTF-1; TTF-I"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73550556"
ORIGIN      
acttccgcttcctcaacagcagcacttccgggttgggagaaaggtggcggcgctttcggagggttagaacctgcaaatgaagaacacaatgtggaaacagctgaagattccgaaataagatacttatctgcagattcaggagatgccgatgattcagatgcggatttgggttctgccgtgaaacagcttcaggagttcattcctaacatcaaggacagggccaccagcacaatcaagcggatgtaccgggacgacttggaacggtttaaggaatttaaagcacaaggtgtcgctattaaatttggcaagttttctgtaaaggaaaataagcagttagagaaaaatgtggaagactttctagccctgacaggcattgagagtgcagacaagctgctgtacacggacagatatcctgaggaaaaatctgtgatcaccaacttaaaaaggagatactcgtttagattacacattggtaggaacattgcccggccctggaaacttatatactatcgagcaaagaagatgttcgatgtcaacaattacaaaggcaggtatagcgaaggagatactgagaagttaaagatgtaccattctctccttgggaatgactggaagacgattggtgagatggtggcccgaagtagcctctccgtggccctcaagttctcacagatcagcagtcaaagaaatcgtggtgcttggagtaagtctgaaacccggaaactaatcaaggctgtcgaagaagtgattctgaagaagatgtctccccaggagttaaaagaggtggattccaaactccaagaaaatcctgaaagttgcctatcaattgttcgggaaaaactctacaagggcatatcttgggtagaagtagaagctaaagtgcaaaccagaaattggatgcagtgtaaaagtaagtggacagaaattctaaccaagaggatgactaatggtcggcgtatctactatggcatgaatgccctgcgggccaaggtcagccttattgaaaggttgtatgaaataaatgtggaagatactaatgaaatagactgggaagatcttgctagtgccataggtgatgttcctccatcttacgttcaaactaaattttctaggctgaaagctgtctatgttccattttggcagaaaaagacttttccagagatcatcgactacctttatgagacgactctacctttgctgaaggaaaagttagaaaaaatgatggagaaaaaaggcactaaaatccagactcctgcagcacccaagcaagttttcccatttcgagacatcttttattatgaagacgatagtgaaggagaggacatagaaaaagaaagcgaaggccaggcgccatgcatggctcacgcctgtaattccagtactttgggaggccaaggccggtggatcatctgaggtcaggagttcgagaccggcctgaccaacatggtgaagacctgtcactattaaaaatgcaaaaattagccgggtgtggtagtgcacacctgtaatttcaactacttgggaggctgaggcaggagaattgcttgaacccaggaggtggaggttgcagtgagccaagatcgcaccaccgcatgagagagagagattactatttcttgtccctttttctcagtttgattatatttatatacatatgtcagtaaatctgttttcagtattgatgtttaataaagaatgtacaatggccagagttctactctttcctctggagcattaaaatatattgccattcctattaaaacgtatttgaatgtgaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:7270 -> Molecular function: GO:0003677 [DNA binding] evidence: IEA
            GeneID:7270 -> Molecular function: GO:0003682 [chromatin binding] evidence: IEA
            GeneID:7270 -> Biological process: GO:0006338 [chromatin remodeling] evidence: IEA
            GeneID:7270 -> Biological process: GO:0006353 [DNA-dependent transcription, termination] evidence: NAS
            GeneID:7270 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: IEA
            GeneID:7270 -> Biological process: GO:0006360 [transcription from RNA polymerase I promoter] evidence: TAS
            GeneID:7270 -> Biological process: GO:0006361 [transcription initiation from RNA polymerase I promoter] evidence: IEA
            GeneID:7270 -> Biological process: GO:0006363 [termination of RNA polymerase I transcription] evidence: TAS
            GeneID:7270 -> Biological process: GO:0008156 [negative regulation of DNA replication] evidence: IEA
            GeneID:7270 -> Biological process: GO:0010467 [gene expression] evidence: TAS
            GeneID:7270 -> Cellular component: GO:0005634 [nucleus] evidence: NAS
            GeneID:7270 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
            GeneID:7270 -> Cellular component: GO:0005730 [nucleolus] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.