Home |
Help |
Advanced search
2025-05-09 20:35:55, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001204398 1874 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens paired-like homeodomain 2 (PITX2), transcript variant
5, mRNA.
ACCESSION NM_001204398
VERSION NM_001204398.1 GI:324710993
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1874)
AUTHORS Zhang,J.X., Tong,Z.T., Yang,L., Wang,F., Chai,H.P., Zhang,F.,
Xie,M.R., Zhang,A.L., Wu,L.M., Hong,H., Yin,L., Wang,H., Wang,H.Y.
and Zhao,Y.
TITLE PITX2: a promising predictive biomarker of patients' prognosis and
chemoradioresistance in esophageal squamous cell carcinoma
JOURNAL Int. J. Cancer 132 (11), 2567-2577 (2013)
PUBMED 23132660
REMARK GeneRIF: High expression of PITX2 was associated with
chemoradioresistance in esophageal squamous cell carcinoma.
REFERENCE 2 (bases 1 to 1874)
AUTHORS Zhang,Z., Gutierrez,D., Li,X., Bidlack,F., Cao,H., Wang,J.,
Andrade,K., Margolis,H.C. and Amendt,B.A.
TITLE The LIM homeodomain transcription factor LHX6: a transcriptional
repressor that interacts with pituitary homeobox 2 (PITX2) to
regulate odontogenesis
JOURNAL J. Biol. Chem. 288 (4), 2485-2500 (2013)
PUBMED 23229549
REMARK GeneRIF: LHX6 is a transcriptional repressor that interacts with
pituitary homeobox 2 (PITX2) to regulate odontogenesis
REFERENCE 3 (bases 1 to 1874)
AUTHORS Bevan,S., Traylor,M., Adib-Samii,P., Malik,R., Paul,N.L.,
Jackson,C., Farrall,M., Rothwell,P.M., Sudlow,C., Dichgans,M. and
Markus,H.S.
TITLE Genetic heritability of ischemic stroke and the contribution of
previously reported candidate gene and genomewide associations
JOURNAL Stroke 43 (12), 3161-3167 (2012)
PUBMED 23042660
REMARK GeneRIF: 3 loci from related cardiovascular genomewide studies were
significant: PHACTR1 in large-vessel disease (P=2.63e(-6)), PITX2
in cardioembolic stroke (P=4.78e(-8)), and ZFHX3 in cardioembolic
stroke (P=5.50e(-7)).
REFERENCE 4 (bases 1 to 1874)
AUTHORS Traylor M, Farrall M, Holliday EG, Sudlow C, Hopewell JC, Cheng YC,
Fornage M, Ikram MA, Malik R, Bevan S, Thorsteinsdottir U, Nalls
MA, Longstreth W, Wiggins KL, Yadav S, Parati EA, Destefano AL,
Worrall BB, Kittner SJ, Khan MS, Reiner AP, Helgadottir A,
Achterberg S, Fernandez-Cadenas I, Abboud S, Schmidt R, Walters M,
Chen WM, Ringelstein EB, O'Donnell M, Ho WK, Pera J, Lemmens R,
Norrving B, Higgins P, Benn M, Sale M, Kuhlenbaumer G, Doney AS,
Vicente AM, Delavaran H, Algra A, Davies G, Oliveira SA, Palmer CN,
Deary I, Schmidt H, Pandolfo M, Montaner J, Carty C, de Bakker PI,
Kostulas K, Ferro JM, van Zuydam NR, Valdimarsson E, Nordestgaard
BG, Lindgren A, Thijs V, Slowik A, Saleheen D, Pare G, Berger K,
Thorleifsson G, Hofman A, Mosley TH, Mitchell BD, Furie K, Clarke
R, Levi C, Seshadri S, Gschwendtner A, Boncoraglio GB, Sharma P,
Bis JC, Gretarsdottir S, Psaty BM, Rothwell PM, Rosand J, Meschia
JF, Stefansson K, Dichgans M and Markus HS.
CONSRTM Australian Stroke Genetics Collaborative, Wellcome Trust Case
Control Consortium 2 (WTCCC2); International Stroke Genetics
Consortium
TITLE Genetic risk factors for ischaemic stroke and its subtypes (the
METASTROKE collaboration): a meta-analysis of genome-wide
association studies
JOURNAL Lancet Neurol 11 (11), 951-962 (2012)
PUBMED 23041239
REFERENCE 5 (bases 1 to 1874)
AUTHORS Li,Q., Pan,H., Guan,L., Su,D. and Ma,X.
TITLE CITED2 mutation links congenital heart defects to dysregulation of
the cardiac gene VEGF and PITX2C expression
JOURNAL Biochem. Biophys. Res. Commun. 423 (4), 895-899 (2012)
PUBMED 22735262
REMARK GeneRIF: CITED2 variants decreased its ability to mediate the
expression of vascular endothelial growth factor (VEGF) and the
expression of the paired-like homeodomain transcription factor
2-gamma (PITX2C), both of which are closely related to cardiac
development.
REFERENCE 6 (bases 1 to 1874)
AUTHORS Pellegrini-Bouiller,I., Manrique,C., Gunz,G., Grino,M.,
Zamora,A.J., Figarella-Branger,D., Grisoli,F., Jaquet,P. and
Enjalbert,A.
TITLE Expression of the members of the Ptx family of transcription
factors in human pituitary adenomas
JOURNAL J. Clin. Endocrinol. Metab. 84 (6), 2212-2220 (1999)
PUBMED 10372733
REFERENCE 7 (bases 1 to 1874)
AUTHORS Amendt,B.A., Sutherland,L.B., Semina,E.V. and Russo,A.F.
TITLE The molecular basis of Rieger syndrome. Analysis of Pitx2
homeodomain protein activities
JOURNAL J. Biol. Chem. 273 (32), 20066-20072 (1998)
PUBMED 9685346
REFERENCE 8 (bases 1 to 1874)
AUTHORS Arakawa,H., Nakamura,T., Zhadanov,A.B., Fidanza,V., Yano,T.,
Bullrich,F., Shimizu,M., Blechman,J., Mazo,A., Canaani,E. and
Croce,C.M.
TITLE Identification and characterization of the ARP1 gene, a target for
the human acute leukemia ALL1 gene
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 95 (8), 4573-4578 (1998)
PUBMED 9539779
REFERENCE 9 (bases 1 to 1874)
AUTHORS Alward,W.L., Semina,E.V., Kalenak,J.W., Heon,E., Sheth,B.P.,
Stone,E.M. and Murray,J.C.
TITLE Autosomal dominant iris hypoplasia is caused by a mutation in the
Rieger syndrome (RIEG/PITX2) gene
JOURNAL Am. J. Ophthalmol. 125 (1), 98-100 (1998)
PUBMED 9437321
REFERENCE 10 (bases 1 to 1874)
AUTHORS Semina,E.V., Reiter,R., Leysens,N.J., Alward,W.L., Small,K.W.,
Datson,N.A., Siegel-Bartelt,J., Bierke-Nelson,D., Bitoun,P.,
Zabel,B.U., Carey,J.C. and Murray,J.C.
TITLE Cloning and characterization of a novel bicoid-related homeobox
transcription factor gene, RIEG, involved in Rieger syndrome
JOURNAL Nat. Genet. 14 (4), 392-399 (1996)
PUBMED 8944018
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BP372081.1 and BC106010.1.
Summary: This gene encodes a member of the RIEG/PITX homeobox
family, which is in the bicoid class of homeodomain proteins. The
encoded protein acts as a transcription factor and regulates
procollagen lysyl hydroxylase gene expression. This protein plays a
role in the terminal differentiation of somatotroph and lactotroph
cell phenotypes, is involved in the development of the eye, tooth
and abdominal organs, and acts as a transcriptional regulator
involved in basal and hormone-regulated activity of prolactin.
Mutations in this gene are associated with Axenfeld-Rieger
syndrome, iridogoniodysgenesis syndrome, and sporadic cases of
Peters anomaly. A similar protein in other vertebrates is involved
in the determination of left-right asymmetry during development.
Alternatively spliced transcript variants encoding distinct
isoforms have been described. [provided by RefSeq, Jul 2008].
Transcript Variant: This variant (5) lacks an exon in the 5' UTR,
as compared to variant 2. Variants 2, 4 and 5 encode the same
isoform b.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BX403546.2 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025090 [ECO:0000348]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-555 BP372081.1 1-555
556-1874 BC106010.1 428-1746
FEATURES Location/Qualifiers
source 1..1874
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="4"
/map="4q25"
gene 1..1874
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/note="paired-like homeodomain 2"
/db_xref="GeneID:5308"
/db_xref="HGNC:9005"
/db_xref="MIM:601542"
exon 1..205
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/inference="alignment:Splign:1.39.8"
exon 206..261
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/inference="alignment:Splign:1.39.8"
misc_feature 207..209
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/note="upstream in-frame stop codon"
CDS 216..1169
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/note="isoform b is encoded by transcript variant 5;
paired-like homeodomain transcription factor 2; rieg
bicoid-related homeobox transcription factor 1;
all1-responsive gene 1; solurshin; pituitary homeobox 2;
homeobox protein PITX2; ALL1-responsive protein ARP1"
/codon_start=1
/product="pituitary homeobox 2 isoform b"
/protein_id="NP_001191327.1"
/db_xref="GI:324710994"
/db_xref="CCDS:CCDS3692.1"
/db_xref="GeneID:5308"
/db_xref="HGNC:9005"
/db_xref="MIM:601542"
/translation="
METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV
"
misc_feature 471..647
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/note="Homeodomain; DNA binding domains involved in the
transcriptional regulation of key eukaryotic developmental
processes; may bind to DNA as monomers or as homo- and/or
heterodimers, in a sequence-specific manner; Region:
homeodomain; cd00086"
/db_xref="CDD:28970"
misc_feature order(471..485,489..491,540..542,558..560,597..599,
603..608,615..620,624..632,636..641)
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/note="DNA binding site [nucleotide binding]"
/db_xref="CDD:28970"
misc_feature order(477..479,486..488,606..608,615..620,627..629)
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/note="specific DNA base contacts [nucleotide binding];
other site"
/db_xref="CDD:28970"
misc_feature 1035..1091
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/note="OAR domain; Region: OAR; pfam03826"
/db_xref="CDD:146451"
misc_feature 1050..1091
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q99697.2);
Region: OAR"
misc_feature 1068..1082
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q99697.2);
Region: Nuclear localization signal (Potential)"
variation 252
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/replace="c"
/replace="g"
/db_xref="dbSNP:1131942"
exon 262..399
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/inference="alignment:Splign:1.39.8"
exon 400..605
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/inference="alignment:Splign:1.39.8"
variation 510
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/replace="c"
/replace="g"
/db_xref="dbSNP:1051887"
exon 606..1871
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/inference="alignment:Splign:1.39.8"
variation 1100
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/replace="c"
/replace="g"
/db_xref="dbSNP:1051888"
variation 1118
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/replace="a"
/replace="c"
/db_xref="dbSNP:2739199"
variation 1193
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/replace="c"
/replace="g"
/db_xref="dbSNP:1051889"
STS 1627..1758
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/standard_name="D4S3305"
/db_xref="UniSTS:47798"
STS 1627..1754
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/standard_name="SHGC-50188"
/db_xref="UniSTS:81619"
variation 1726
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/replace="c"
/replace="g"
/db_xref="dbSNP:2739201"
variation 1728
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
/replace="c"
/replace="g"
/db_xref="dbSNP:2739202"
polyA_site 1871
/gene="PITX2"
/gene_synonym="ARP1; Brx1; IDG2; IGDS; IGDS2; IHG2; IRID2;
Otlx2; PTX2; RGS; RIEG; RIEG1; RS"
ORIGIN
gcagtctgtgtaagttttcatatctctgagtgtgtgcacacagtggagagggtggagcctgccatcctcaaatctgaaaagattgagagatttcagagggcccagatgtgccaaaggtcagagggatcaatatacaggccctaccacggaaaggcggggaaaaggttcgaatagaaaactgctgcagaagggaagccactgagagataacggggaatggagaccaactgccgcaaactggtgtcggcgtgtgtgcaattaggcgtgcagccggcggccgttgaatgtctcttctccaaagactccgaaatcaaaaaggtcgagttcacggactctcctgagagccgaaaagaggcagccagcagcaagttcttcccgcggcagcatcctggcgccaatgagaaagataaaagccagcaggggaagaatgaggacgtgggcgccgaggacccgtctaagaagaagcggcaaaggcggcagcggactcactttaccagccagcagctccaggagctggaggccactttccagaggaaccgctacccggacatgtccacacgcgaagaaatcgctgtgtggaccaaccttacggaagcccgagtccgggtttggttcaagaatcgtcgggccaaatggagaaagagggagcgcaaccagcaggccgagctatgcaagaatggcttcgggccgcagttcaatgggctcatgcagccctacgacgacatgtacccaggctattcctacaacaactgggccgccaagggccttacatccgcctccctatccaccaagagcttccccttcttcaactctatgaacgtcaaccccctgtcatcacagagcatgttttccccacccaactctatctcgtccatgagcatgtcgtccagcatggtgccctcagcagtgacaggcgtcccgggctccagtctcaacagcctgaataacttgaacaacctgagtagcccgtcgctgaattccgcggtgccgacgcctgcctgtccttacgcgccgccgactcctccgtatgtttatagggacacgtgtaactcgagcctggccagcctgagactgaaagcaaagcagcactccagcttcggctacgccagcgtgcagaacccggcctccaacctgagtgcttgccagtatgcagtggaccggcccgtgtgagccgcacccacagcgccgggatcctaggaccttgccggatggggcaactccgcccttgaaagactgggaattatgctagaaggtcgtgggcactaaagaaagggagagaaagagaagctatatagagaaaaggaaaccactgaatcaaagagagagctcctttgatttcaaagggatgtcctcagtgtctgacatctttcactacaagtatttctaacagttgcaaggacacatacacaaacaaatgtttgactggatatgacattttaacattactataagcttgttattttttaagtttagcattgttaacatttaaatgactgaaaggatgtatatatatcgaaatgtcaaattaattttataaaagcagttgttagtaatatcacaacagtgtttttaaaggttaggctttaaaataaagcatgttatacagaagcgattaggatttttcgcttgcgagcaagggagtgtatatactaaatgccacactgtatgtttctaacatattattattattataaaaaatgtgtgaatatcagttttagaatagtttctctggtggatgcaatgatgtttctgaaactgctatgtacaacctaccctgtgtataacatttcgtacaatattattgttttacttttcagcaaatatgaaacaaatgtgttttatttcatgggagtaaaatatactgcatacaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:5308 -> Molecular function: GO:0000976 [transcription regulatory region sequence-specific DNA binding] evidence: IDA
GeneID:5308 -> Molecular function: GO:0000978 [RNA polymerase II core promoter proximal region sequence-specific DNA binding] evidence: IEA
GeneID:5308 -> Molecular function: GO:0001077 [RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription] evidence: IEA
GeneID:5308 -> Molecular function: GO:0001078 [RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription] evidence: IDA
GeneID:5308 -> Molecular function: GO:0001085 [RNA polymerase II transcription factor binding] evidence: IPI
GeneID:5308 -> Molecular function: GO:0001102 [RNA polymerase II activating transcription factor binding] evidence: IPI
GeneID:5308 -> Molecular function: GO:0001105 [RNA polymerase II transcription coactivator activity] evidence: IDA
GeneID:5308 -> Molecular function: GO:0001191 [RNA polymerase II transcription factor binding transcription factor activity involved in negative regulation of transcription] evidence: IDA
GeneID:5308 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IDA
GeneID:5308 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:5308 -> Molecular function: GO:0008134 [transcription factor binding] evidence: IPI
GeneID:5308 -> Molecular function: GO:0031490 [chromatin DNA binding] evidence: IEA
GeneID:5308 -> Molecular function: GO:0042803 [protein homodimerization activity] evidence: IPI
GeneID:5308 -> Molecular function: GO:0043021 [ribonucleoprotein complex binding] evidence: IC
GeneID:5308 -> Molecular function: GO:0051219 [phosphoprotein binding] evidence: IPI
GeneID:5308 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: IDA
GeneID:5308 -> Biological process: GO:0001569 [patterning of blood vessels] evidence: IEA
GeneID:5308 -> Biological process: GO:0001570 [vasculogenesis] evidence: IEA
GeneID:5308 -> Biological process: GO:0001701 [in utero embryonic development] evidence: IEA
GeneID:5308 -> Biological process: GO:0001764 [neuron migration] evidence: IEA
GeneID:5308 -> Biological process: GO:0002074 [extraocular skeletal muscle development] evidence: IEA
GeneID:5308 -> Biological process: GO:0003171 [atrioventricular valve development] evidence: IEA
GeneID:5308 -> Biological process: GO:0003253 [cardiac neural crest cell migration involved in outflow tract morphogenesis] evidence: ISS
GeneID:5308 -> Biological process: GO:0003350 [pulmonary myocardium development] evidence: IEA
GeneID:5308 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: IDA
GeneID:5308 -> Biological process: GO:0007368 [determination of left/right symmetry] evidence: ISS
GeneID:5308 -> Biological process: GO:0007520 [myoblast fusion] evidence: IEA
GeneID:5308 -> Biological process: GO:0008584 [male gonad development] evidence: IEA
GeneID:5308 -> Biological process: GO:0008585 [female gonad development] evidence: IEA
GeneID:5308 -> Biological process: GO:0009725 [response to hormone stimulus] evidence: IEA
GeneID:5308 -> Biological process: GO:0016055 [Wnt receptor signaling pathway] evidence: IEA
GeneID:5308 -> Biological process: GO:0021763 [subthalamic nucleus development] evidence: IEA
GeneID:5308 -> Biological process: GO:0021855 [hypothalamus cell migration] evidence: IEA
GeneID:5308 -> Biological process: GO:0030334 [regulation of cell migration] evidence: IEA
GeneID:5308 -> Biological process: GO:0031076 [embryonic camera-type eye development] evidence: IEA
GeneID:5308 -> Biological process: GO:0033189 [response to vitamin A] evidence: IEA
GeneID:5308 -> Biological process: GO:0035116 [embryonic hindlimb morphogenesis] evidence: IEA
GeneID:5308 -> Biological process: GO:0035315 [hair cell differentiation] evidence: IC
GeneID:5308 -> Biological process: GO:0035886 [vascular smooth muscle cell differentiation] evidence: IEA
GeneID:5308 -> Biological process: GO:0035993 [deltoid tuberosity development] evidence: IMP
GeneID:5308 -> Biological process: GO:0042475 [odontogenesis of dentin-containing tooth] evidence: IEA
GeneID:5308 -> Biological process: GO:0042476 [odontogenesis] evidence: IMP
GeneID:5308 -> Biological process: GO:0043010 [camera-type eye development] evidence: IMP
GeneID:5308 -> Biological process: GO:0043388 [positive regulation of DNA binding] evidence: IEA
GeneID:5308 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IDA
GeneID:5308 -> Biological process: GO:0048536 [spleen development] evidence: ISS
GeneID:5308 -> Biological process: GO:0048557 [embryonic digestive tract morphogenesis] evidence: IEA
GeneID:5308 -> Biological process: GO:0055009 [atrial cardiac muscle tissue morphogenesis] evidence: IEA
GeneID:5308 -> Biological process: GO:0055015 [ventricular cardiac muscle cell development] evidence: IEA
GeneID:5308 -> Biological process: GO:0060126 [somatotropin secreting cell differentiation] evidence: TAS
GeneID:5308 -> Biological process: GO:0060127 [prolactin secreting cell differentiation] evidence: TAS
GeneID:5308 -> Biological process: GO:0060412 [ventricular septum morphogenesis] evidence: IEA
GeneID:5308 -> Biological process: GO:0060460 [left lung morphogenesis] evidence: IEA
GeneID:5308 -> Biological process: GO:0060577 [pulmonary vein morphogenesis] evidence: IEA
GeneID:5308 -> Biological process: GO:0060578 [superior vena cava morphogenesis] evidence: IEA
GeneID:5308 -> Biological process: GO:0061031 [endodermal digestive tract morphogenesis] evidence: IEA
GeneID:5308 -> Biological process: GO:0061072 [iris morphogenesis] evidence: IMP
GeneID:5308 -> Biological process: GO:0061325 [cell proliferation involved in outflow tract morphogenesis] evidence: ISS
GeneID:5308 -> Biological process: GO:0070986 [left/right axis specification] evidence: ISS
GeneID:5308 -> Biological process: GO:2000288 [positive regulation of myoblast proliferation] evidence: IEA
GeneID:5308 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:5308 -> Cellular component: GO:0005667 [transcription factor complex] evidence: IDA
GeneID:5308 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.