GGRNA Home | Help | Advanced search

2025-05-09 20:18:04, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001199535            1090 bp    mRNA    linear   PRI 07-JUL-2013
DEFINITION  Homo sapiens TGIF2-C20orf24 readthrough (TGIF2-C20orf24), mRNA.
ACCESSION   NM_001199535
VERSION     NM_001199535.1  GI:313747554
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1090)
  AUTHORS   Prakash,T., Sharma,V.K., Adati,N., Ozawa,R., Kumar,N., Nishida,Y.,
            Fujikake,T., Takeda,T. and Taylor,T.D.
  TITLE     Expression of conjoined genes: another mechanism for gene
            regulation in eukaryotes
  JOURNAL   PLoS ONE 5 (10), E13284 (2010)
   PUBMED   20967262
  REMARK    Publication Status: Online-Only
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL050318.13.
            
            Summary: This locus represents naturally occurring read-through
            transcription between the neighboring TGIF2 (TGFB-induced factor
            homeobox 2) and C20orf24 (chromosome 20 open reading frame 24)
            genes. The read-through transcript encodes a fusion protein that
            shares sequence identity with each individual gene product.
            [provided by RefSeq, Dec 2010].
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BX377269.2 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025085 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            readthrough transcript :: includes exons from GeneID 55969, 60436
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-82                AL050318.13        85272-85353
            83-308              AL050318.13        89459-89684
            309-412             AL050318.13        118433-118536
            413-542             AL050318.13        120319-120448
            543-1090            AL050318.13        122728-123275
FEATURES             Location/Qualifiers
     source          1..1090
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="20"
                     /map="20q"
     gene            1..1090
                     /gene="TGIF2-C20orf24"
                     /note="TGIF2-C20orf24 readthrough"
                     /db_xref="GeneID:100527943"
                     /db_xref="HGNC:44664"
     exon            1..82
                     /gene="TGIF2-C20orf24"
                     /inference="alignment:Splign:1.39.8"
     exon            83..308
                     /gene="TGIF2-C20orf24"
                     /inference="alignment:Splign:1.39.8"
     variation       89
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374969064"
     variation       96
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368026783"
     misc_feature    102..104
                     /gene="TGIF2-C20orf24"
                     /note="upstream in-frame stop codon"
     CDS             117..584
                     /gene="TGIF2-C20orf24"
                     /codon_start=1
                     /product="TGIF2-C20orf24 protein"
                     /protein_id="NP_001186464.1"
                     /db_xref="GI:313747555"
                     /db_xref="CCDS:CCDS58772.1"
                     /db_xref="GeneID:100527943"
                     /db_xref="HGNC:44664"
                     /translation="
MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQDEFLDVIYWFRQIIAVVLGVIWGVLPLRGFLGIAGFCLINAGVLYLYFSNYLQIDEEEYGGTWELTKEGFMTSFALFMVIWIIFYTAIHYD
"
     misc_feature    171..>338
                     /gene="TGIF2-C20orf24"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(171..185,189..191,249..251,267..269,306..308,
                     327..332)
                     /gene="TGIF2-C20orf24"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(177..179,186..188,330..332)
                     /gene="TGIF2-C20orf24"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    321..563
                     /gene="TGIF2-C20orf24"
                     /note="Rab5-interacting protein (Rab5ip); Region: Rab5ip;
                     pfam07019"
                     /db_xref="CDD:148567"
     variation       143
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370918031"
     variation       152
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373991636"
     variation       163
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371719080"
     variation       203
                     /gene="TGIF2-C20orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142209425"
     variation       231
                     /gene="TGIF2-C20orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:147784268"
     variation       239
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6028205"
     variation       244
                     /gene="TGIF2-C20orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:368202205"
     variation       247
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371990676"
     variation       266
                     /gene="TGIF2-C20orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375356918"
     variation       292
                     /gene="TGIF2-C20orf24"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200411969"
     exon            309..412
                     /gene="TGIF2-C20orf24"
                     /inference="alignment:Splign:1.39.8"
     variation       331
                     /gene="TGIF2-C20orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200467555"
     variation       359
                     /gene="TGIF2-C20orf24"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:145335248"
     variation       379
                     /gene="TGIF2-C20orf24"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199502068"
     exon            413..542
                     /gene="TGIF2-C20orf24"
                     /inference="alignment:Splign:1.39.8"
     variation       444
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374405285"
     variation       487
                     /gene="TGIF2-C20orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368627271"
     variation       493
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149230426"
     exon            543..1090
                     /gene="TGIF2-C20orf24"
                     /inference="alignment:Splign:1.39.8"
     variation       553
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138244240"
     variation       589
                     /gene="TGIF2-C20orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145156759"
     variation       593
                     /gene="TGIF2-C20orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:369227155"
     variation       616
                     /gene="TGIF2-C20orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372092965"
     variation       623
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138992970"
     variation       636
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143917410"
     variation       643
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200804664"
     variation       655
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190742083"
     variation       670
                     /gene="TGIF2-C20orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140513057"
     variation       683
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375889787"
     variation       687
                     /gene="TGIF2-C20orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2232911"
     variation       690
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202088044"
     variation       692
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138333574"
     variation       705
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367602721"
     variation       706
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200128148"
     variation       708
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141883588"
     variation       709
                     /gene="TGIF2-C20orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376043012"
     STS             716..997
                     /gene="TGIF2-C20orf24"
                     /standard_name="WI-19258"
                     /db_xref="UniSTS:75642"
     STS             716..883
                     /gene="TGIF2-C20orf24"
                     /standard_name="D20S1010"
                     /db_xref="UniSTS:47881"
     variation       741
                     /gene="TGIF2-C20orf24"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:150570188"
     variation       743
                     /gene="TGIF2-C20orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6028360"
     variation       794
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1060320"
     STS             799..956
                     /gene="TGIF2-C20orf24"
                     /standard_name="HUM000AA21"
                     /db_xref="UniSTS:81340"
     variation       814
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111270662"
     variation       952..953
                     /gene="TGIF2-C20orf24"
                     /replace=""
                     /replace="atc"
                     /db_xref="dbSNP:142502467"
     variation       967
                     /gene="TGIF2-C20orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182263194"
     variation       982
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11540276"
     variation       984
                     /gene="TGIF2-C20orf24"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376471373"
     variation       1033
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:11643"
     variation       1058
                     /gene="TGIF2-C20orf24"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:7870"
ORIGIN      
cccgcgccccgaagagtcggccagccccgaactgccggagtaggggtgggaaccaaactttttcctgccccgggacagacacgtttacccaaggtccagcctagcccctaggcaccatgtcggacagtgatctaggtgaggacgaaggcctcctctccctggcgggcaaaaggaagcgcagggggaacctgcccaaggagtcggtgaagatcctccgggactggctgtacttgcaccgctacaacgcctacccctcagagcaggagaagctgagcctttctggacagaccaacctgtcagtgctgcaagatgaatttttagatgtgatctactggttccgacagatcattgctgtggtcctgggtgtcatttggggagttttgccattacgagggttcttgggaatagcaggattctgcctgatcaatgcaggagtcctgtacctctacttcagcaattacctacagattgatgaggaagaatatggtggcacgtgggagctcacgaaggaagggtttatgacctcttttgccttgttcatggtcatttggatcatcttttacactgccatccattatgactgatggtgtacagctcccaagtgctccctatccagtccaaaggaccctcttgattacagcacaggaacttgatcgttggggaaccccagccccttggaacttggaagacccgtgtttcctggaccgcgaatcagtgtgttgggcatcagtgttttctgcaagggttgtgacctgaaactttttaaaaaccacccacctttggggaagcatttctgaatttatccatcaccaaccatttcttcttggataccatcaagtaacagctattatttgccaagtggagctgtcatttaatttgatgcacctctggattcagatgaaacattaaattgtcttcctcgattctccatcgggtgtagagtttttaaactatcaatggcatttcaagtcttctgaaacagcatggctgtatgtgcgtggtccatagcacagtacatgcagcatctaataagagtttccattgtagaatgttttcacatacttgaataaatcaaatctttaattgagaa
//

Annotations:



by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.