GGRNA Home | Help | Advanced search

2025-05-09 20:07:03, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001199513            3328 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens TGFB-induced factor homeobox 2 (TGIF2), transcript
            variant 3, mRNA.
ACCESSION   NM_001199513
VERSION     NM_001199513.1  GI:313747516
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3328)
  AUTHORS   Powers,S.E., Taniguchi,K., Yen,W., Melhuish,T.A., Shen,J.,
            Walsh,C.A., Sutherland,A.E. and Wotton,D.
  TITLE     Tgif1 and Tgif2 regulate Nodal signaling and are required for
            gastrulation
  JOURNAL   Development 137 (2), 249-259 (2010)
   PUBMED   20040491
  REMARK    GeneRIF: Shows that the homologous mouse Tgif2 gene is necessary
            for gastrulation.
REFERENCE   2  (bases 1 to 3328)
  AUTHORS   Suzuki,M. and Yoshino,I.
  TITLE     Identification of microRNAs caused by DNA methylation that induce
            metastasis
  JOURNAL   Future Oncol 4 (6), 775-777 (2008)
   PUBMED   19086843
REFERENCE   3  (bases 1 to 3328)
  AUTHORS   Lujambio,A., Calin,G.A., Villanueva,A., Ropero,S.,
            Sanchez-Cespedes,M., Blanco,D., Montuenga,L.M., Rossi,S.,
            Nicoloso,M.S., Faller,W.J., Gallagher,W.M., Eccles,S.A., Croce,C.M.
            and Esteller,M.
  TITLE     A microRNA DNA methylation signature for human cancer metastasis
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 105 (36), 13556-13561 (2008)
   PUBMED   18768788
REFERENCE   4  (bases 1 to 3328)
  AUTHORS   Spagnoli,F.M. and Brivanlou,A.H.
  TITLE     The Gata5 target, TGIF2, defines the pancreatic region by
            modulating BMP signals within the endoderm
  JOURNAL   Development 135 (3), 451-461 (2008)
   PUBMED   18094028
REFERENCE   5  (bases 1 to 3328)
  AUTHORS   Lips,E.H., van Eijk,R., de Graaf,E.J., Oosting,J., de Miranda,N.F.,
            Karsten,T., van de Velde,C.J., Eilers,P.H., Tollenaar,R.A., van
            Wezel,T. and Morreau,H.
  TITLE     Integrating chromosomal aberrations and gene expression profiles to
            dissect rectal tumorigenesis
  JOURNAL   BMC Cancer 8, 314 (2008)
   PUBMED   18959792
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 3328)
  AUTHORS   Melhuish,T.A. and Wotton,D.
  TITLE     The Tgif2 gene contains a retained intron within the coding
            sequence
  JOURNAL   BMC Mol. Biol. 7, 2 (2006)
   PUBMED   16436215
  REMARK    Publication Status: Online-Only
REFERENCE   7  (bases 1 to 3328)
  AUTHORS   Chung,C.M., Man,C., Jin,Y., Jin,C., Guan,X.Y., Wang,Q., Wan,T.S.,
            Cheung,A.L. and Tsao,S.W.
  TITLE     Amplification and overexpression of aurora kinase A (AURKA) in
            immortalized human ovarian epithelial (HOSE) cells
  JOURNAL   Mol. Carcinog. 43 (3), 165-174 (2005)
   PUBMED   15880741
REFERENCE   8  (bases 1 to 3328)
  AUTHORS   Watanabe,T., Imoto,I., Katahira,T., Hirasawa,A., Ishiwata,I.,
            Emi,M., Takayama,M., Sato,A. and Inazawa,J.
  TITLE     Differentially regulated genes as putative targets of
            amplifications at 20q in ovarian cancers
  JOURNAL   Jpn. J. Cancer Res. 93 (10), 1114-1122 (2002)
   PUBMED   12417041
REFERENCE   9  (bases 1 to 3328)
  AUTHORS   Melhuish,T.A., Gallo,C.M. and Wotton,D.
  TITLE     TGIF2 interacts with histone deacetylase 1 and represses
            transcription
  JOURNAL   J. Biol. Chem. 276 (34), 32109-32114 (2001)
   PUBMED   11427533
REFERENCE   10 (bases 1 to 3328)
  AUTHORS   Imoto,I., Pimkhaokham,A., Watanabe,T., Saito-Ohara,F., Soeda,E. and
            Inazawa,J.
  TITLE     Amplification and overexpression of TGIF2, a novel homeobox gene of
            the TALE superclass, in ovarian cancer cell lines
  JOURNAL   Biochem. Biophys. Res. Commun. 276 (1), 264-270 (2000)
   PUBMED   11006116
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL705108.1, AK074802.1,
            BQ881960.1 and BI869422.1.
            
            Summary: The protein encoded by this gene is a DNA-binding homeobox
            protein and a transcriptional repressor, which appears to repress
            transcription by recruiting histone deacetylases to TGF
            beta-responsive genes. This gene is amplified and over-expressed in
            some ovarian cancers. Alternative splicing results in multiple
            transcript variants. A related pseudogene has been identified on
            chromosome 1. Read-through transcription also exists between this
            gene and the neighboring downstream C20orf24 (chromosome 20 open
            reading frame 24) gene. [provided by RefSeq, Dec 2010].
            
            Transcript Variant: This variant (3) differs in the 5' UTR compared
            to variant 1. All variants (1-4) encode the same protein.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AL705108.1, HY120072.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025085, ERS025086 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-379               AL705108.1         1-379
            380-2123            AK074802.1         447-2190
            2124-2157           BQ881960.1         191-224
            2158-3312           AK074802.1         2225-3379
            3313-3328           BI869422.1         426-441
FEATURES             Location/Qualifiers
     source          1..3328
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="20"
                     /map="20q11.23"
     gene            1..3328
                     /gene="TGIF2"
                     /note="TGFB-induced factor homeobox 2"
                     /db_xref="GeneID:60436"
                     /db_xref="HGNC:15764"
                     /db_xref="MIM:607294"
     exon            1..52
                     /gene="TGIF2"
                     /inference="alignment:Splign:1.39.8"
     exon            53..278
                     /gene="TGIF2"
                     /inference="alignment:Splign:1.39.8"
     variation       59
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374969064"
     variation       66
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368026783"
     misc_feature    72..74
                     /gene="TGIF2"
                     /note="upstream in-frame stop codon"
     CDS             87..800
                     /gene="TGIF2"
                     /note="TGF(beta)-induced transcription factor 2;
                     TGFB-induced factor 2 (TALE family homeobox);
                     transcription growth factor-beta-induced factor 2;
                     5'-TG-3' interacting factor 2; TGF-beta-induced
                     transcription factor 2"
                     /codon_start=1
                     /product="homeobox protein TGIF2"
                     /protein_id="NP_001186442.1"
                     /db_xref="GI:313747517"
                     /db_xref="CCDS:CCDS13278.1"
                     /db_xref="GeneID:60436"
                     /db_xref="HGNC:15764"
                     /db_xref="MIM:607294"
                     /translation="
MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ
"
     misc_feature    141..314
                     /gene="TGIF2"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(141..155,159..161,219..221,237..239,276..278,
                     282..287,294..299,303..311)
                     /gene="TGIF2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(147..149,156..158,285..287,294..299,306..308)
                     /gene="TGIF2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     misc_feature    393..797
                     /gene="TGIF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9GZN2.1);
                     Region: Repressive function"
     misc_feature    630..632
                     /gene="TGIF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine; propagated from
                     UniProtKB/Swiss-Prot (Q9GZN2.1); phosphorylation site"
     misc_feature    642..644
                     /gene="TGIF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine; propagated from
                     UniProtKB/Swiss-Prot (Q9GZN2.1); phosphorylation site"
     variation       113
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370918031"
     variation       122
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373991636"
     variation       133
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371719080"
     variation       173
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142209425"
     variation       201
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:147784268"
     variation       209
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6028205"
     variation       214
                     /gene="TGIF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:368202205"
     variation       217
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371990676"
     variation       236
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375356918"
     variation       262
                     /gene="TGIF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200411969"
     exon            279..3317
                     /gene="TGIF2"
                     /inference="alignment:Splign:1.39.8"
     variation       309
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375974955"
     variation       332
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369009714"
     variation       374
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139445684"
     variation       388
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373249992"
     variation       398
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375316891"
     variation       406
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199621279"
     variation       410
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200072791"
     variation       423
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151198555"
     variation       431..432
                     /gene="TGIF2"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:368920356"
     variation       484
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150460801"
     variation       504
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199730218"
     variation       529
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374216319"
     variation       565
                     /gene="TGIF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201632959"
     variation       671
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140990544"
     variation       692
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200959739"
     variation       737
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377713562"
     variation       749
                     /gene="TGIF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200681657"
     variation       812
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372115125"
     variation       819
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:181179141"
     variation       822
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375919073"
     variation       852
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186881499"
     STS             865..1747
                     /gene="TGIF2"
                     /standard_name="TGIF2_2062"
                     /db_xref="UniSTS:281054"
     variation       1149
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6065106"
     variation       1226..1230
                     /gene="TGIF2"
                     /replace=""
                     /replace="aaaga"
                     /db_xref="dbSNP:377212348"
     variation       1260
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140265869"
     variation       1305..1308
                     /gene="TGIF2"
                     /replace=""
                     /replace="tccc"
                     /db_xref="dbSNP:370950422"
     variation       1307
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188876883"
     variation       1352
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6101370"
     variation       1373
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182005523"
     variation       1451
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6101371"
     variation       1495
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75484069"
     variation       1510
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:186240598"
     variation       1534..1535
                     /gene="TGIF2"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:200293257"
     variation       1542
                     /gene="TGIF2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:71901663"
     variation       1550..1551
                     /gene="TGIF2"
                     /replace=""
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:60964912"
     variation       1581
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74748470"
     variation       1720
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:4812359"
     STS             1730..1841
                     /gene="TGIF2"
                     /standard_name="A008R12"
                     /db_xref="UniSTS:4908"
     variation       1755
                     /gene="TGIF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:75858122"
     variation       1755
                     /gene="TGIF2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:113760296"
     variation       1779
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6101373"
     variation       1863
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376493075"
     variation       1880
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150382819"
     variation       1894
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138103023"
     variation       1927
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:71351028"
     variation       2124
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6016004"
     variation       2183
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:190701127"
     variation       2365
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143715787"
     variation       2382
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145811351"
     variation       2403
                     /gene="TGIF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1140732"
     variation       2463
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182600714"
     variation       2471
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:367638483"
     variation       2533
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138657186"
     variation       2615
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41276988"
     variation       2621
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371836516"
     variation       2648..2650
                     /gene="TGIF2"
                     /replace=""
                     /replace="ggat"
                     /db_xref="dbSNP:60435168"
     variation       2648..2649
                     /gene="TGIF2"
                     /replace=""
                     /replace="tgga"
                     /db_xref="dbSNP:112208120"
     variation       2648
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:151113715"
     variation       2649
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200316735"
     variation       2650
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201285664"
     variation       2674..2675
                     /gene="TGIF2"
                     /replace=""
                     /replace="at"
                     /db_xref="dbSNP:201834011"
     variation       2746
                     /gene="TGIF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185940389"
     variation       2765
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142756264"
     variation       2859
                     /gene="TGIF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:41276990"
     variation       2969
                     /gene="TGIF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:113228049"
     STS             2999..3250
                     /gene="TGIF2"
                     /standard_name="G07338"
                     /db_xref="UniSTS:83129"
     variation       3003
                     /gene="TGIF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1052112"
     STS             3046..3186
                     /gene="TGIF2"
                     /standard_name="RH77695"
                     /db_xref="UniSTS:16603"
     STS             3156..3235
                     /gene="TGIF2"
                     /standard_name="D20S561E"
                     /db_xref="UniSTS:64316"
     variation       3265
                     /gene="TGIF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:201975059"
     variation       3268..3274
                     /gene="TGIF2"
                     /replace=""
                     /replace="ttttgtc"
                     /db_xref="dbSNP:199875415"
     variation       3274
                     /gene="TGIF2"
                     /replace=""
                     /replace="ttttgtc"
                     /db_xref="dbSNP:111396010"
     polyA_signal    3283..3288
                     /gene="TGIF2"
     variation       3289
                     /gene="TGIF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:183220779"
     variation       3298
                     /gene="TGIF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:187660553"
     polyA_site      3315
                     /gene="TGIF2"
     polyA_site      3317
                     /gene="TGIF2"
ORIGIN      
ccgacggcccgccccgcggggggtgggcgcagctcgtcgcgctccgcacaaagtttacccaaggtccagcctagcccctaggcaccatgtcggacagtgatctaggtgaggacgaaggcctcctctccctggcgggcaaaaggaagcgcagggggaacctgcccaaggagtcggtgaagatcctccgggactggctgtacttgcaccgctacaacgcctacccctcagagcaggagaagctgagcctttctggacagaccaacctgtcagtgctgcaaatatgtaactggttcatcaatgcccggcggcggcttctcccagacatgcttcggaaggatggcaaagaccctaatcagtttaccatttcccgccgcgggggtaaggcctcagatgtggccctcccccgtggcagcagcccctcagtgctggctgtgtctgtcccagcccccaccaatgtgctctccctgtctgtgtgctccatgccgcttcactcaggccagggggaaaagccagcagcccctttcccacgtggggagctggagtctcccaagcccctggtgacccctggtagcacacttactctgctgaccagggctgaggctggaagccccacaggtggactcttcaacacgccaccacccacacccccagagcaggacaaagaggacttcagcagcttccagctgctggtggaggtggcgctacagagggctgctgagatggagcttcagaagcagcaggacccatcactcccattactgcacactcccatccctttagtctctgaaaatccccagtaggcatctgccaagaagggtgctgaaggctccagccagctgtcctgggtttccgttttggttccctttcatacagagggttttctatggatcactgccaaacattgggatcatctcctctgtccagaggtcttcaacaggaagatgccagctggcaccactgcactgtgatgggggccctctcctctgctgactctgccgtttctccaggcctccgctcagtgatgagaccaagagatcggagacaagcatggtgctgctgcttctgctgcttctccagaaaatccctgggacacctttgttccagcctggtttcctgggctgggctcaggaaagctgccaaattcagtcctatgttgggtccaagctgcccctgtgctgtttctgtcaagccaggtgtggacattccaagttcatatgcgtgaacaaaagaaaagaggaacccagtggatgtaacagaaccgactccagttgaatgtttagatttttgctaaactgttttctttttcccttttttgctgtggtttgcattcacggcagtagttagcccaggtgtggggaacgagagtgcactgcatgatagcgttctggtgagctgggaaggacccaccactgccactgaggattgttttggaagaaaggaatatttttatcttggggaccagctaagtctctgcagtagtgtgaaattccaaatggttgttttatcattggtttggtttaccaaaaaaaaggcagggaaaaaaaaaaaaaacaaccgtatgagcgcattggcttgtctgccgcaggcacagaagggtagaaagccacagcagggggcagtccagcagactctgactcaactttctaggcacctagcagagaaagataagatcaaaaggtgtttggtttttcttttaatttttattgtagtttttttgggtgggtgggggaagtaaactagactgaagcgatggattttttttttcttttttttctttagtgtttttccctttgttcttgaacacttttgccctgcagcctcagttttgaattcttttagcaacttggattagaggggcccatatgtcagaagctcccagcacctcctacttgggagaaaagtgagccatctgctggtcaggaagtcctccagagaggcagcttttcccacaatggtggcaggaaactttggggaaagcaggaatggtgtccactgctgcggaggaactgccttcagagaaggtggggctggaaaagggttagaagcctcctagctgggattgtctttgtttcacctttctttaaattagaattacagaagcccctgcccagtgaacagataacgattggtcttatgctcctccctttcccccattttttcttttgctgttttgttttttgttttttgtttgtttgtttgtttttttgagacagagtcatgctctgtcacccgggctggagtgcagtggtgcgatctcagctcactgtaacctccgcctcccgggttcaagcaattatttgcctcagcctcccgagtagctgggattataggcacccgccaccatgtctggcttttagtagagacggggtttcaccatcttggccaggctggtcttggaactcctgacctcgtgagccaccacgcccagcctcttttgctgtttcattgctgacagtgttcaacaatatgccccatctttatatatcctaagaaacactaatcctaggttattgctagccaaaatatttttgtcctgagtagtgtcactgggccaaaagatagatcaggacgacagcctttagttttcctgaaatcaccaggtcaggcacaaggagaaaaggttcctggatactgactaacttgggtgggtctagccaggagaaagacagtaacatgtgttctgtactttctgggaagatccctgaagccatcacagaggctccccaacttctgagtcgcccatctgttgctgtgggagtgtgaacggatcgctgaaggagagggagctttgctctctctaggtgggcaagtttcctgggctctctgtgttgcctccctctggcttcttcctcccgtgccctctccccgtgtgccccagggggatcagggatcctcaccctcctgaggcccagtggggaagaatgaacatggcttcatccaggttaactgatgctgccatttgcccagcctcttccatcccagccctgtcagtgagcccaggtctggtgcaactgctgcaggatgcctgtagtagggaactctggaagtgtattgggctgaggtgggattttccctccccacagtgcactgagcaatggagggtggtgagggagccatgctgctgaattctggttggcatttccccattatgtaaaatggggtgttgggtagggcagactctgcttgggtttggttgtaagataaacctggaggagaagcacagttgtcccattgaattatttgagcaaaaactactgtaaataacttttttgtcttttgtcaaataaaatttttttttgtttttttaagcagaaacaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:60436 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: NAS
            GeneID:60436 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:60436 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: IMP
            GeneID:60436 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: TAS
            GeneID:60436 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: TAS
            GeneID:60436 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: NAS
            GeneID:60436 -> Biological process: GO:0006367 [transcription initiation from RNA polymerase II promoter] evidence: TAS
            GeneID:60436 -> Biological process: GO:0007179 [transforming growth factor beta receptor signaling pathway] evidence: TAS
            GeneID:60436 -> Biological process: GO:0010467 [gene expression] evidence: TAS
            GeneID:60436 -> Cellular component: GO:0005634 [nucleus] evidence: TAS
            GeneID:60436 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.