LOCUS       NM_001195517            2146 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens T-cell leukemia homeobox 1 (TLX1), transcript variant
            2, mRNA.
ACCESSION   NM_001195517
VERSION     NM_001195517.1  GI:306922376
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2146)
  AUTHORS   Dadi,S., Le Noir,S., Payet-Bornet,D., Lhermitte,L.,
            Zacarias-Cabeza,J., Bergeron,J., Villarese,P., Vachez,E., Dik,W.A.,
            Millien,C., Radford,I., Verhoeyen,E., Cosset,F.L., Petit,A.,
            Ifrah,N., Dombret,H., Hermine,O., Spicuglia,S., Langerak,A.W.,
            Macintyre,E.A., Nadel,B., Ferrier,P. and Asnafi,V.
  TITLE     TLX homeodomain oncogenes mediate T cell maturation arrest in T-ALL
            via interaction with ETS1 and suppression of TCRalpha gene
            expression
  JOURNAL   Cancer Cell 21 (4), 563-576 (2012)
   PUBMED   22516263
  REMARK    GeneRIF: The cortical thymic maturation arrest in T-lineage Acute
            lymphoblastic leukemias (ALLs) that overexpress TLX1 or TLX3 is due
            to binding of TLX1/TLX3 to ETS1.
REFERENCE   2  (bases 1 to 2146)
  AUTHORS   Della Gatta,G., Palomero,T., Perez-Garcia,A., Ambesi-Impiombato,A.,
            Bansal,M., Carpenter,Z.W., De Keersmaecker,K., Sole,X., Xu,L.,
            Paietta,E., Racevskis,J., Wiernik,P.H., Rowe,J.M., Meijerink,J.P.,
            Califano,A. and Ferrando,A.A.
  TITLE     Reverse engineering of TLX oncogenic transcriptional networks
            identifies RUNX1 as tumor suppressor in T-ALL
  JOURNAL   Nat. Med. 18 (3), 436-440 (2012)
   PUBMED   22366949
  REMARK    GeneRIF: these results place TLX1 and TLX3 at the top of an
            oncogenic transcriptional network controlling leukemia development,
            and identify RUNX1 as a tumor-suppressor gene in T-ALL
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 2146)
  AUTHORS   Rakowski,L.A., Lehotzky,E.A. and Chiang,M.Y.
  TITLE     Transient responses to NOTCH and TLX1/HOX11 inhibition in T-cell
            acute lymphoblastic leukemia/lymphoma
  JOURNAL   PLoS ONE 6 (2), E16761 (2011)
   PUBMED   21326611
  REMARK    GeneRIF: Suppression of TLX1 expression slowed the growth of TLX1
            tumor cell lines. Suppression of TLX1 in vivo also transiently
            delayed leukemia progression.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 2146)
  AUTHORS   De Keersmaecker,K., Real,P.J., Gatta,G.D., Palomero,T., Sulis,M.L.,
            Tosello,V., Van Vlierberghe,P., Barnes,K., Castillo,M., Sole,X.,
            Hadler,M., Lenz,J., Aplan,P.D., Kelliher,M., Kee,B.L.,
            Pandolfi,P.P., Kappes,D., Gounari,F., Petrie,H., Van der Meulen,J.,
            Speleman,F., Paietta,E., Racevskis,J., Wiernik,P.H., Rowe,J.M.,
            Soulier,J., Avran,D., Cave,H., Dastugue,N., Raimondi,S.,
            Meijerink,J.P., Cordon-Cardo,C., Califano,A. and Ferrando,A.A.
  TITLE     The TLX1 oncogene drives aneuploidy in T cell transformation
  JOURNAL   Nat. Med. 16 (11), 1321-1327 (2010)
   PUBMED   20972433
  REMARK    GeneRIF: Transgenic expression of human TLX1 in mice induces T cell
            acute lymphoblastic leukemia with frequent deletions and mutations
            in Bcl11b.
REFERENCE   5  (bases 1 to 2146)
  AUTHORS   Dear,T.N., Sanchez-Garcia,I. and Rabbitts,T.H.
  TITLE     The HOX11 gene encodes a DNA-binding nuclear transcription factor
            belonging to a distinct family of homeobox genes
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 90 (10), 4431-4435 (1993)
   PUBMED   8099440
REFERENCE   6  (bases 1 to 2146)
  AUTHORS   Lu,M., Zhang,N. and Ho,A.D.
  TITLE     Genomic organization of the putative human homeobox proto-oncogene
            HOX-11 (TCL-3) and its endogenous expression in T cells
  JOURNAL   Oncogene 7 (7), 1325-1330 (1992)
   PUBMED   1352396
REFERENCE   7  (bases 1 to 2146)
  AUTHORS   Kennedy,M.A., Gonzalez-Sarmiento,R., Kees,U.R., Lampert,F.,
            Dear,N., Boehm,T. and Rabbitts,T.H.
  TITLE     HOX11, a homeobox-containing T-cell oncogene on human chromosome
            10q24
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 88 (20), 8900-8904 (1991)
   PUBMED   1681546
REFERENCE   8  (bases 1 to 2146)
  AUTHORS   Lu,M., Gong,Z.Y., Shen,W.F. and Ho,A.D.
  TITLE     The tcl-3 proto-oncogene altered by chromosomal translocation in
            T-cell leukemia codes for a homeobox protein
  JOURNAL   EMBO J. 10 (10), 2905-2910 (1991)
   PUBMED   1717256
REFERENCE   9  (bases 1 to 2146)
  AUTHORS   Hatano,M., Roberts,C.W., Minden,M., Crist,W.M. and Korsmeyer,S.J.
  TITLE     Deregulation of a homeobox gene, HOX11, by the t(10;14) in T cell
            leukemia
  JOURNAL   Science 253 (5015), 79-82 (1991)
   PUBMED   1676542
REFERENCE   10 (bases 1 to 2146)
  AUTHORS   McAlpine,P.J. and Shows,T.B.
  TITLE     Nomenclature for human homeobox genes
  JOURNAL   Genomics 7 (3), 460 (1990)
   PUBMED   1973146
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BC130530.1, AL357395.13 and
            BF514683.1.
            
            Summary: This gene encodes a nuclear transcription factor that
            belongs to the NK-linked or NK-like (NKL) subfamily of homeobox
            genes. The encoded protein is required for normal development of
            the spleen during embryogenesis. This protein is also involved in
            specification of neuronal cell fates. Ectopic expression of this
            gene due to chromosomal translocations is associated with certain
            T-cell acute lymphoblastic leukemias. Alternate splicing results in
            multiple transcript variants. [provided by RefSeq, Sep 2010].
            
            Transcript Variant: This variant (2) uses an alternate splice site
            in the 3' coding region, compared to variant 1. It encodes isoform
            2, which has a shorter C-terminus, compared to isoform 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC130530.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025088 [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1139              BC130530.1         1-1139
            1140-1140           AL357395.13        40537-40537
            1141-1640           BC130530.1         1141-1640
            1641-1641           AL357395.13        41038-41038
            1642-1838           BC130530.1         1642-1838
            1839-2146           BF514683.1         1-308               c
FEATURES             Location/Qualifiers
     source          1..2146
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="10"
                     /map="10q24"
     gene            1..2146
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /note="T-cell leukemia homeobox 1"
                     /db_xref="GeneID:3195"
                     /db_xref="HGNC:5056"
                     /db_xref="MIM:186770"
     exon            1..806
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /inference="alignment:Splign:1.39.8"
     variation       14
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377362073"
     variation       127
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:7100938"
     CDS             239..1012
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /note="isoform 2 is encoded by transcript variant 2; homeo
                     box-11 (T-cell leukemia-3 associated breakpoint,
                     homologous to Drosophila Notch); proto-oncogene TCL-3;
                     homeobox protein Hox-11; T-cell leukemia/lymphoma protein
                     3"
                     /codon_start=1
                     /product="T-cell leukemia homeobox protein 1 isoform 2"
                     /protein_id="NP_001182446.1"
                     /db_xref="GI:306922377"
                     /db_xref="CCDS:CCDS55725.1"
                     /db_xref="GeneID:3195"
                     /db_xref="HGNC:5056"
                     /db_xref="MIM:186770"
                     /translation="

MEHLGPHHLHPGHAEPISFGIDQILNSPDQGGCMGPASRLQDGEYGLGCLVGGAYTYGGGGSAAATGAGGAGAYGTGGPGGPGGPAGGGGACSMGPLTGSYNVNMALAGGPGPGGGGGSSGGAGALSAAGVIRVPAHRPLAGAVAHPQPLATGLPTVPSVPAMPGVNNLTGLTFPWMESNRRYTKDRFTGHPYQNRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKWR

"
     misc_feature    851..1009
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(851..856,860..862,911..913,929..931,968..970,
                     974..979,986..991,995..1003,1007..1009)
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(857..859,977..979,986..991,998..1000)
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     misc_feature    944..946
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N6-acetyllysine; propagated from
                     UniProtKB/Swiss-Prot (P31314.1); acetylation site"
     variation       260
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142285605"
     variation       289
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200315484"
     variation       292
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150815977"
     variation       295
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372550407"
     variation       318
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369093136"
     variation       330
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140202357"
     variation       374
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376987512"
     variation       384
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:145612659"
     variation       393
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199727081"
     variation       395
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201643256"
     variation       400
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11599711"
     variation       449
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2742015"
     variation       620
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113474709"
     variation       672
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200573821"
     variation       682
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112343556"
     variation       700
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201689744"
     variation       711
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369095303"
     variation       730
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147731896"
     variation       738
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372467288"
     variation       742
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147737669"
     variation       763
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2742016"
     STS             776..1127
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /standard_name="Tlx1"
                     /db_xref="UniSTS:274200"
     variation       778
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377546639"
     variation       785
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:202240073"
     exon            807..1008
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /inference="alignment:Splign:1.39.8"
     variation       838
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:7090185"
     variation       849
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199599233"
     variation       893
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376735855"
     variation       901
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149702067"
     variation       909
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145523858"
     exon            1009..2130
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /inference="alignment:Splign:1.39.8"
     variation       1031
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:61873916"
     variation       1092
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373379278"
     variation       1119
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:180989542"
     variation       1124
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:148841378"
     variation       1164
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372719781"
     variation       1176
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377699039"
     variation       1193..1194
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:34165728"
     variation       1206
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2742036"
     variation       1232
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143449957"
     variation       1243
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200084897"
     variation       1259
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201964898"
     variation       1308
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2516329"
     variation       1333
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2516328"
     variation       1385
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2235128"
     variation       1411
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183736856"
     variation       1433
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17113735"
     variation       1434
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2742037"
     variation       1453
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190562307"
     variation       1460
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2788724"
     variation       1475
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:182205974"
     variation       1641
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1051723"
     variation       1656
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376682740"
     variation       1671
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2742038"
     variation       1703
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:146574082"
     STS             1722..1984
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /standard_name="RH17718"
                     /db_xref="UniSTS:28358"
     variation       1731
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2742039"
     variation       1777
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:75473078"
     variation       1795
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1051724"
     STS             1797..1913
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /standard_name="D10S2182"
                     /db_xref="UniSTS:15576"
     variation       1889
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3740499"
     variation       1895
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1051725"
     variation       2015
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373272723"
     variation       2103
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:186793431"
     polyA_signal    2109..2114
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
     polyA_site      2130
                     /gene="TLX1"
                     /gene_synonym="HOX11; TCL3"
ORIGIN      

tcccagagtcaacagcgagcgagcagccggagcggggaagcagaagccagagaggggaagaatacggcgccccctctctccctcccctcccccttctactttagcctttctgcgcacttcgcttccaagtctccgcgcagccaggagccgctgttgcctcccagcccctgctagctgccccccgagccgagcgcagcgagcgccgccgcccgggccccccggtggggccagggccagcatggagcacctgggtccgcaccacctccacccgggtcacgcagagcccattagcttcggcatcgaccagatcctcaacagcccggaccagggtggctgcatgggacccgcctcgcgcctccaggacggagaatacggccttggctgcttggtcggaggcgcctacacttacggcggcgggggctccgcggccgcgacgggggctggaggagcgggggcctatggtactggaggtcccggcggccccggaggcccggcaggcggcggcggcgcctgcagcatgggtcctctgaccggctcctacaacgtgaacatggccttggcaggcggccccggtcctggcggcggcggcggcagcagcggcggtgccggggcactcagcgctgcgggggtaatccgggtgccggcacacaggccgctcgccggagccgtggcccacccccagcccctggccaccggcttgcccaccgtgccctctgtgcctgccatgccgggcgtcaacaacctcactggcctcaccttcccctggatggagagtaaccgcagatacacaaaggacaggttcacaggtcacccctatcagaaccggacgccccccaagaagaagaagccgcgcacgtccttcacacgcctgcagatctgcgagctggagaagcgcttccaccgccagaagtacctggcctcggccgagcgcgccgccctggccaaggcgctcaaaatgaccgatgcgcaggtcaaaacctggttccagaaccggcggacaaagtggaggtaacggcttgttcccggtgcagacggcagactgcggaggaacgggaggccgagaggcagcaagcgaaccgcatcctcctgcagttgcagcaggaggccttccagaagagcctggcacagccgctgcccgctgaccctctgtgcgtgcacaactcgtcgctcttcgccctgcagaatctgcagccgtggtctgacgactcgaccaaaatcactagcgtcacgtcggtggcgtcggcctgcgagtgagcctgcccattctgccctgtgggaccccaggcccactcaggggtcactgaggcctgagacccaggactcctccccaccctcctggcctcagactgcacccaggaggggaacactgccctcgcacggccccgaagggcccccacatttgtgccgacactgttctcccttcggtggaagagctcaagggacaaggacacgcgcccccctcccagaggcgtcccgcacctgtctgaactgttaagaaatctgtttttgtttatttcattttattttaatttttaacgtgggattcagagaaaggcaagggaggtaagggaggaggagcttctggggtccccagggctgtcatctgaatttgccctgggaaaccccttctctgtgacccacttctcatcacacacatggaaacccataggcccacacacaggtggtgtcactgtccctcctggtgtcaccccagagccacacatgggcatctatgggagagtgtcaaccagacagagggtcacagtgtttacactttggaccttacgatcaggcacaggtcaggggtgacacagactcatcctgaacagcatggcactccctccagcacaaacacaaggtcatggccacactgtgacacactacaccacacacaacagccaacagctacaacagcctcacttggtctgccaggcccccaccacacatcccagcccaatccaggtacgcacagacaggttttcacataaatgcagcccatttctccagaacccatttgaggggtgggggggtgttaatttatgcacttataaggtgttttctgtgtaaccattttataaagtgcttgtgtaatttatgtgaaaaaaataaataaaagcctccggatccggaaaaaaaaaaaaaaaaa

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:3195 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:3195 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:3195 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:3195 -> Molecular function: GO:0046982 [protein heterodimerization activity] evidence: IEA
            GeneID:3195 -> Biological process: GO:0007417 [central nervous system development] evidence: IEA
            GeneID:3195 -> Biological process: GO:0008284 [positive regulation of cell proliferation] evidence: IEA
            GeneID:3195 -> Biological process: GO:0030182 [neuron differentiation] evidence: IEA
            GeneID:3195 -> Biological process: GO:0045165 [cell fate commitment] evidence: IEA
            GeneID:3195 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IEA
            GeneID:3195 -> Biological process: GO:0048536 [spleen development] evidence: IEA
            GeneID:3195 -> Biological process: GO:0048645 [organ formation] evidence: IEA
            GeneID:3195 -> Cellular component: GO:0005634 [nucleus] evidence: IEA