GGRNA | NM_001159542.1

LOCUS       NM_001159542            1599 bp    mRNA    linear   PRI 02-JUN-2013
DEFINITION  Homo sapiens POU class 5 homeobox 1B (POU5F1B), mRNA.
ACCESSION   NM_001159542
VERSION     NM_001159542.1  GI:227430409
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1599)
  AUTHORS   Dentelli,P., Barale,C., Togliatto,G., Trombetta,A., Olgasi,C.,
            Gili,M., Riganti,C., Toppino,M. and Brizzi,M.F.
  TITLE     A diabetic milieu promotes OCT4 and NANOG production in human
            visceral-derived adipose stem cells
  JOURNAL   Diabetologia 56 (1), 173-184 (2013)
   PUBMED   23064289
  REMARK    GeneRIF: Data suggest that expression of Oct4 and NANOG (Nanog
            homeobox protein) is up-regulated in visceral adipose tissue stem
            cells in type 2 diabetes as compared to control; expression is also
            up-regulated in hyperglycemic conditions.
REFERENCE   2  (bases 1 to 1599)
  AUTHORS   Clark,S.L., Adkins,D.E., Aberg,K., Hettema,J.M., McClay,J.L.,
            Souza,R.P. and van den Oord,E.J.
  TITLE     Pharmacogenomic study of side-effects for antidepressant treatment
            options in STAR*D
  JOURNAL   Psychol Med 42 (6), 1151-1162 (2012)
   PUBMED   22041458
REFERENCE   3  (bases 1 to 1599)
  AUTHORS   White,K.L., Sellers,T.A., Fridley,B.L., Vierkant,R.A., Phelan,C.M.,
            Tsai,Y.Y., Kalli,K.R., Berchuck,A., Iversen,E.S., Hartmann,L.C.,
            Liebow,M., Armasu,S., Fredericksen,Z., Larson,M.C., Duggan,D.,
            Couch,F.J., Schildkraut,J.M., Cunningham,J.M. and Goode,E.L.
  TITLE     Variation at 8q24 and 9p24 and risk of epithelial ovarian cancer
  JOURNAL   Twin Res Hum Genet 13 (1), 43-56 (2010)
   PUBMED   20158306
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   4  (bases 1 to 1599)
  AUTHORS   Crowther-Swanepoel,D., Broderick,P., Di Bernardo,M.C.,
            Dobbins,S.E., Torres,M., Mansouri,M., Ruiz-Ponte,C., Enjuanes,A.,
            Rosenquist,R., Carracedo,A., Jurlander,J., Campo,E., Juliusson,G.,
            Montserrat,E., Smedby,K.E., Dyer,M.J., Matutes,E., Dearden,C.,
            Sunter,N.J., Hall,A.G., Mainou-Fowler,T., Jackson,G.H.,
            Summerfield,G., Harris,R.J., Pettitt,A.R., Allsup,D.J.,
            Bailey,J.R., Pratt,G., Pepper,C., Fegan,C., Parker,A., Oscier,D.,
            Allan,J.M., Catovsky,D. and Houlston,R.S.
  TITLE     Common variants at 2q37.3, 8q24.21, 15q21.3 and 16q24.1 influence
            chronic lymphocytic leukemia risk
  JOURNAL   Nat. Genet. 42 (2), 132-136 (2010)
   PUBMED   20062064
REFERENCE   5  (bases 1 to 1599)
  AUTHORS   Panagopoulos,I., Moller,E., Collin,A. and Mertens,F.
  TITLE     The POU5F1P1 pseudogene encodes a putative protein similar to
            POU5F1 isoform 1
  JOURNAL   Oncol. Rep. 20 (5), 1029-1033 (2008)
   PUBMED   18949397
  REMARK    GeneRIF: that a putative POU5F1P1 protein is localized in the
            nucleus, acts as a transcriptional activator and regulates the
            expression in a similar way to the POU5F1 isoform 1
REFERENCE   6  (bases 1 to 1599)
  AUTHORS   Firsova,N.V., Markintantova,Iu.V., Smirnova,Iu.A., Panova,I.G.,
            Sukhikh,G.T., Zinov'eva,R.D. and Mitashov,V.I.
  TITLE     [Identification of the OCT4-pg1 retrogene and NANOG gene expression
            in the human embryonic eye]
  JOURNAL   Izv. Akad. Nauk. Ser. Biol. 2, 134-138 (2008)
   PUBMED   18946985
REFERENCE   7  (bases 1 to 1599)
  AUTHORS   Yeager,M., Orr,N., Hayes,R.B., Jacobs,K.B., Kraft,P., Wacholder,S.,
            Minichiello,M.J., Fearnhead,P., Yu,K., Chatterjee,N., Wang,Z.,
            Welch,R., Staats,B.J., Calle,E.E., Feigelson,H.S., Thun,M.J.,
            Rodriguez,C., Albanes,D., Virtamo,J., Weinstein,S.,
            Schumacher,F.R., Giovannucci,E., Willett,W.C., Cancel-Tassin,G.,
            Cussenot,O., Valeri,A., Andriole,G.L., Gelmann,E.P., Tucker,M.,
            Gerhard,D.S., Fraumeni,J.F. Jr., Hoover,R., Hunter,D.J.,
            Chanock,S.J. and Thomas,G.
  TITLE     Genome-wide association study of prostate cancer identifies a
            second risk locus at 8q24
  JOURNAL   Nat. Genet. 39 (5), 645-649 (2007)
   PUBMED   17401363
REFERENCE   8  (bases 1 to 1599)
  AUTHORS   Suo,G., Han,J., Wang,X., Zhang,J., Zhao,Y., Zhao,Y. and Dai,J.
  TITLE     Oct4 pseudogenes are transcribed in cancers
  JOURNAL   Biochem. Biophys. Res. Commun. 337 (4), 1047-1051 (2005)
   PUBMED   16229821
REFERENCE   9  (bases 1 to 1599)
  AUTHORS   Marques,A.C., Dupanloup,I., Vinckenbosch,N., Reymond,A. and
            Kaessmann,H.
  TITLE     Emergence of young human genes after a burst of retroposition in
            primates
  JOURNAL   PLoS Biol. 3 (11), E357 (2005)
   PUBMED   16201836
REFERENCE   10 (bases 1 to 1599)
  AUTHORS   Takeda,J., Seino,S. and Bell,G.I.
  TITLE     Human Oct3 gene family: cDNA sequences, alternative splicing, gene
            organization, chromosomal location, and expression at low levels in
            adult tissues
  JOURNAL   Nucleic Acids Res. 20 (17), 4613-4620 (1992)
   PUBMED   1408763
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DQ486513.1.
            
            Summary: This intronless gene was thought to be a transcribed
            pseudogene of POU class 5 homeobox 1, however, it has been reported
            that this gene can encode a functional protein. The encoded protein
            is nearly the same length as and highly similar to the POU class 5
            homeobox 1 transcription factor, has been shown to be a weak
            transcriptional activator and may play a role in carcinogenesis and
            eye development. [provided by RefSeq, Apr 2009].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript is intronless :: DQ486513.1 [ECO:0000345]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1599              DQ486513.1         1-1599
FEATURES             Location/Qualifiers
     source          1..1599
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="8"
                     /map="8q24.21"
     gene            1..1599
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /note="POU class 5 homeobox 1B"
                     /db_xref="GeneID:5462"
                     /db_xref="HGNC:9223"
     exon            1..1599
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /inference="alignment:Splign:1.39.8"
     variation       21
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:3999777"
     variation       32
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:185974252"
     variation       41..43
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="ata"
                     /db_xref="dbSNP:112002137"
     variation       43..45
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="aat"
                     /db_xref="dbSNP:374993968"
     variation       166
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190348884"
     variation       205
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4871789"
     misc_feature    208..210
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /note="upstream in-frame stop codon"
     variation       232
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:75427380"
     CDS             256..1335
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /note="POU class 5 homeobox 1 pseudogene 1; POU domain,
                     class 5, transcription factor 1 pseudogene 1; POU 5 domain
                     protein; POU domain transcription factor Oct-4; POU domain
                     transcription factor OCT4-pg1; octamer binding protein
                     3_like sequence"
                     /codon_start=1
                     /product="putative POU domain, class 5, transcription
                     factor 1B"
                     /protein_id="NP_001153014.1"
                     /db_xref="GI:227430410"
                     /db_xref="CCDS:CCDS55274.1"
                     /db_xref="GeneID:5462"
                     /db_xref="HGNC:9223"
                     /translation="

MAGHLASDFAFSPPPGGGGDGPWGAEPGWVDPLTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGVGVESNSNGASPEPCTVPPGAVKLEKEKLEQNPEKSQDIKALQKELEQFAKLLKQKRITLGYTQADVGLILGVLFGKVFSQKTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLMQARKRKRTSIENRVRGNLENLFLQCPKPTLQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPPAPGPHFGTPGYGSPHFTALYSSVPFPEGEVFPPVSVITLGSPMHSN

"
     misc_feature    667..891
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /note="Found in Pit-Oct-Unc transcription factors; Region:
                     POU; smart00352"
                     /db_xref="CDD:197673"
     misc_feature    946..1119
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(946..960,964..966,1015..1017,1030..1032,1069..1071,
                     1075..1080,1087..1092,1096..1104,1108..1113)
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(952..954,961..963,1078..1080,1087..1092,1099..1101)
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     variation       303
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1061391"
     variation       309
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1061393"
     variation       353
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1061394"
     variation       375
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376562387"
     variation       397
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:76449652"
     variation       418
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369395842"
     variation       441
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:3211306"
     variation       462
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1061395"
     variation       555
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:77810828"
     variation       561
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200266503"
     variation       604
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190778660"
     variation       610
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:182632506"
     variation       725
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:188813106"
     variation       736
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140000439"
     variation       782
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6998061"
     variation       800
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:13273814"
     variation       865
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:192151034"
     variation       884
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:377535415"
     variation       895
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:13274084"
     variation       939
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6998254"
     variation       967
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:7002225"
     variation       1055
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182961302"
     variation       1194
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374138216"
     variation       1217
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371019833"
     variation       1258
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148676795"
     variation       1270
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:142141895"
     STS             1341..1455
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /standard_name="POU5F1"
                     /db_xref="UniSTS:479943"
     variation       1360
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373454446"
     variation       1363
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:187298898"
     variation       1366
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371237720"
     variation       1406
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:9297754"
     variation       1459
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:9297755"
     variation       1470
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:78931371"
     variation       1472
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:182512875"
     variation       1558
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188074125"
     variation       1572
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3179559"
     variation       1580
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:192359771"
     variation       1582..1583
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:199935435"
     variation       1595
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200889381"
     variation       1596
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368932899"
     variation       1599
                     /gene="POU5F1B"
                     /gene_synonym="OCT4-PG1; OTF3C; OTF3P1; POU5F1P1;
                     POU5F1P4; POU5FLC20; POU5FLC8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74548710"
ORIGIN

aacatttccaaatcttggcattcttatccacaaagtgaagataataattgtcaattcacaggtgattatgatttaaagagattacttttgaagagttcctaacacattcagtcaacatttaatgatgcttcaggcactgtgttcattgctagtgagcgtatgacacacacagccatacggtcacagagctttcaatgaaaagtaacataattgctcatttcaccaggcccccggcttggggcgccttccttccccatggcgggacacctggcttcggatttcgccttctcgccccctccaggcggtgggggtgatgggccatggggggcggagccgggctgggttgatcctctgacctggctaagcttccaaggccctcctggagggccaggaatcgggccgggggttgggccaggctctgaggtgtgggggattcccccttgccccccgccgtatgagttatgtggggggatggcgtactgtgggcctcaggttggagtggggctagtgccccaaggcggcttggagacctctcagcctgagagcgaagcaggagtcggggtggagagcaactccaatggggcctccccggaaccctgcaccgtcccccctggtgccgtgaagctggagaaggagaagctagagcaaaacccggagaagtcccaggacatcaaagctctgcagaaagaactcgagcaatttgccaagctcctgaagcagaagaggatcaccctgggatatacacaggccgatgtggggctcatcctgggggttctatttgggaaggtgttcagccaaaagaccatctgccgctttgaggctctgcagcttagcttcaagaacatgtgtaagctgcggcccttgctgcagaagtgggtggaggaagctgacaacaatgaaaatcttcaggagatatgcaaagcagaaaccctcatgcaggcccgaaagagaaagcgaaccagtatcgagaaccgagtgagaggcaacctggagaatttgttcctgcagtgcccgaaacccacactgcagatcagccacatcgcccagcagcttgggctcgagaaggatgtggtccgagtgtggttctgtaaccggcgccagaagggcaagcgatcaagcagcgactatgcacaacgagaggattttgaggctgctgggtctcctttctcagggggaccagtgtcctttcctccggccccagggccccattttggtaccccaggctatgggagccctcacttcactgcactgtactcctcagtccctttccctgagggggaagtctttcccccagtctccgtcatcactctgggctctcccatgcattcaaactgaggtgcctgcccttctaggaatggggaacaggggaggggaggagctagggaaagagaacctggagtttgtggcagggcttttgggattaagttcttcattcactaaggaaggaattgggaacactaagggtgggggcaggggagtttggggcaactggttggagggaaggtgaagttcaatgatgctcttgattttaatcccacatcatgtatcacttttttcttaaataaagaagcctgggacacagtaaaaaaaaaaaaaaaa

//

Annotations: