Home |
Help |
Advanced search
2025-05-09 20:15:31, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001145459 1198 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens HOP homeobox (HOPX), transcript variant 4, mRNA. ACCESSION NM_001145459 VERSION NM_001145459.1 GI:224451022 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1198) AUTHORS Willmer,T., Contu,L., Blatch,G.L. and Edkins,A.L. TITLE Knockdown of Hop downregulates RhoC expression, and decreases pseudopodia formation and migration in cancer cell lines JOURNAL Cancer Lett. 328 (2), 252-260 (2013) PUBMED 23036489 REMARK GeneRIF: Knockdown of Hop caused a decrease in the level of RhoC GTPase, and significantly inhibited pseudopodia formation in Hs578T cells. Our data suggest that Hop regulates directional cell migration by multiple unknown mechanisms. REFERENCE 2 (bases 1 to 1198) AUTHORS Katoh,H., Yamashita,K., Waraya,M., Margalit,O., Ooki,A., Tamaki,H., Sakagami,H., Kokubo,K., Sidransky,D. and Watanabe,M. TITLE Epigenetic silencing of HOPX promotes cancer progression in colorectal cancer JOURNAL Neoplasia 14 (7), 559-571 (2012) PUBMED 22904674 REMARK GeneRIF: HOPX-beta promoter methylation is a frequent and cancer-specific event in CRC progression. REFERENCE 3 (bases 1 to 1198) AUTHORS Southworth,D.R. and Agard,D.A. TITLE Client-loading conformation of the Hsp90 molecular chaperone revealed in the cryo-EM structure of the human Hsp90:Hop complex JOURNAL Mol. Cell 42 (6), 771-781 (2011) PUBMED 21700222 REMARK GeneRIF: results identify distinct functions for the Hop cochaperone, revealing an asymmetric mechanism for Hsp90 regulation and client loading REFERENCE 4 (bases 1 to 1198) AUTHORS Trivedi,C.M., Cappola,T.P., Margulies,K.B. and Epstein,J.A. TITLE Homeodomain only protein x is down-regulated in human heart failure JOURNAL J. Mol. Cell. Cardiol. 50 (6), 1056-1058 (2011) PUBMED 21382376 REMARK GeneRIF: HOPX/Hopx expression is reduced in multiple examples of human and murine cardiac hypertrophy and failure. REFERENCE 5 (bases 1 to 1198) AUTHORS Obarzanek-Fojt,M., Favre,B., Kypriotou,M., Ryser,S., Huber,M. and Hohl,D. TITLE Homeodomain-only protein HOP is a novel modulator of late differentiation in keratinocytes JOURNAL Eur. J. Cell Biol. 90 (4), 279-290 (2011) PUBMED 21256618 REMARK GeneRIF: HOP is a novel modulator of late terminal differentiation in keratinocytes REFERENCE 6 (bases 1 to 1198) AUTHORS Kook,H. and Epstein,J.A. TITLE Hopping to the beat. Hop regulation of cardiac gene expression JOURNAL Trends Cardiovasc. Med. 13 (7), 261-264 (2003) PUBMED 14522464 REMARK GeneRIF: One role of Hop is to modify the expression of cardiac-specific genes and thereby finely regulate heart development. Review article REFERENCE 7 (bases 1 to 1198) AUTHORS Kook,H., Lepore,J.J., Gitler,A.D., Lu,M.M., Wing-Man Yung,W., Mackay,J., Zhou,R., Ferrari,V., Gruber,P. and Epstein,J.A. TITLE Cardiac hypertrophy and histone deacetylase-dependent transcriptional repression mediated by the atypical homeodomain protein Hop JOURNAL J. Clin. Invest. 112 (6), 863-871 (2003) PUBMED 12975471 REFERENCE 8 (bases 1 to 1198) AUTHORS Asanoma,K., Matsuda,T., Kondo,H., Kato,K., Kishino,T., Niikawa,N., Wake,N. and Kato,H. TITLE NECC1, a candidate choriocarcinoma suppressor gene that encodes a homeodomain consensus motif JOURNAL Genomics 81 (1), 15-25 (2003) PUBMED 12573257 REMARK GeneRIF: Loss of NECC1 expression is involved in malignant conversion of placental trophoblasts. REFERENCE 9 (bases 1 to 1198) AUTHORS Chen,Y., Petersen,S., Pacyna-Gengelbach,M., Pietas,A. and Petersen,I. TITLE Identification of a novel homeobox-containing gene, LAGY, which is downregulated in lung cancer JOURNAL Oncology 64 (4), 450-458 (2003) PUBMED 12759545 REMARK GeneRIF: Gene mapping locates LAGY on chromosome 4q11-13.1. In 72 primary lung tumors, this gene was significantly down-regulated compared to 9 normal lung tissue samples. REFERENCE 10 (bases 1 to 1198) AUTHORS Adu,J., Leong,F.T., Smith,N.R., Leek,J.P., Markham,A.F., Robinson,P.A. and Mighell,A.J. TITLE Expression of mOb1, a novel atypical 73 amino acid K50-homeodomain protein, during mouse development JOURNAL Mech. Dev. 119 (SUPPL 1), S43-S47 (2002) PUBMED 14516659 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DB180848.1, CB996541.1, AB059410.2 and AA504137.1. Summary: The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Feb 2009]. Transcript Variant: This variant (4) differs in the 5' UTR, lacks a portion of the 5' coding region and uses a downstream translational start codon, compared to variant 1. The resulting isoform (b) is shorter at the N-terminus, compared to isoform a. Variants 2, 3 and 4 encode the same isoform. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BM561848.1, BG772884.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025082, ERS025083 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-36 DB180848.1 21-56 37-730 CB996541.1 29-722 731-1179 AB059410.2 537-985 1180-1198 AA504137.1 1-19 c FEATURES Location/Qualifiers source 1..1198 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="4" /map="4q12" gene 1..1198 /gene="HOPX" /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31; TOTO" /note="HOP homeobox" /db_xref="GeneID:84525" /db_xref="HGNC:24961" /db_xref="MIM:607275" exon 1..223 /gene="HOPX" /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31; TOTO" /inference="alignment:Splign:1.39.8" misc_feature 185..187 /gene="HOPX" /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31; TOTO" /note="upstream in-frame stop codon" exon 224..379 /gene="HOPX" /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31; TOTO" /inference="alignment:Splign:1.39.8" CDS 236..457 /gene="HOPX" /gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31; TOTO" /note="isoform b is encoded by transcript variant 4; not expressed in choriocarcinoma clone 1; lung cancer-associated Y protein; odd homeobox 1 protein; homeodomain-only protein; odd homeobox protein 1; not expressed in choriocarcinoma protein 1" /codon_start=1 /product="homeodomain-only protein isoform b" /protein_id="NP_001138931.1" /db_xref="GI:224451023" /db_xref="CCDS:CCDS3507.1" /db_xref="GeneID:84525" /db_xref="HGNC:24961" /db_xref="MIM:607275" /translation="
MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD
"
misc_feature 263..421
/gene="HOPX"
/gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
TOTO"
/note="Homeodomain; DNA binding domains involved in the
transcriptional regulation of key eukaryotic developmental
processes; may bind to DNA as monomers or as homo- and/or
heterodimers, in a sequence-specific manner; Region:
homeodomain; cd00086"
/db_xref="CDD:28970"
misc_feature order(314..316,332..334,371..373,377..382,389..394,
398..406,410..415)
/gene="HOPX"
/gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
TOTO"
/note="DNA binding site [nucleotide binding]"
/db_xref="CDD:28970"
misc_feature order(380..382,389..394,401..403)
/gene="HOPX"
/gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
TOTO"
/note="specific DNA base contacts [nucleotide binding];
other site"
/db_xref="CDD:28970"
variation 250
/gene="HOPX"
/gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
TOTO"
/replace="a"
/replace="c"
/db_xref="dbSNP:11555051"
variation 268
/gene="HOPX"
/gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
TOTO"
/replace="a"
/replace="g"
/db_xref="dbSNP:11555052"
exon 380..1189
/gene="HOPX"
/gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
TOTO"
/inference="alignment:Splign:1.39.8"
variation 496
/gene="HOPX"
/gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
TOTO"
/replace="c"
/replace="g"
/db_xref="dbSNP:11555050"
STS 888..988
/gene="HOPX"
/gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
TOTO"
/standard_name="A006J04"
/db_xref="UniSTS:23337"
STS 888..988
/gene="HOPX"
/gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
TOTO"
/standard_name="G32360"
/db_xref="UniSTS:116951"
STS 899..1147
/gene="HOPX"
/gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
TOTO"
/standard_name="D4S2787"
/db_xref="UniSTS:65720"
STS 919..1018
/gene="HOPX"
/gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
TOTO"
/standard_name="D4S2900"
/db_xref="UniSTS:79088"
STS 931..1130
/gene="HOPX"
/gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
TOTO"
/standard_name="A006D37"
/db_xref="UniSTS:13043"
STS 931..1130
/gene="HOPX"
/gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
TOTO"
/standard_name="G20731"
/db_xref="UniSTS:13044"
variation 1060
/gene="HOPX"
/gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
TOTO"
/replace="a"
/replace="c"
/db_xref="dbSNP:3184677"
polyA_signal 1155..1160
/gene="HOPX"
/gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
TOTO"
polyA_site 1179
/gene="HOPX"
/gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
TOTO"
polyA_site 1189
/gene="HOPX"
/gene_synonym="CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31;
TOTO"
ORIGIN
gagacagaaggccgcctaccggggaggccggaggccggctagtcgcggactcgggcgaacccaccctcgcgatctgtcaagtctgtccccaggggaggtccccctttcgggaggaagtttttaaggggatttctcaaaatcacccccgcgcttccttcactccttccttagagccggaggtcggtgagggcccgcggaatcatctatctcgcccccgtcgcagcgcgcagggaccatgtcggcggagaccgcgagcggccccacagaggaccaggtggaaatcctggagtacaacttcaacaaggtcgacaagcacccggattccaccacgctgtgcctcatcgcggccgaggcaggcctttccgaggaggagacccagaaatggtttaagcagcgcctggcaaagtggcggcgctcagaaggcctgccctcagagtgcagatccgtcacagactaaggagatggcaggcattgacagcttcactccatgaaggccatctctgtttctctcctccgcttaaccaagctgttgtggtttttcagcatagtgttgtatgttccattgctagctgtcctgctgtttaacacagtgttgtattttttttctaaatgtacataattagaaaagaaaataacaataggaagctatgtgtatcttctgtgtaaagcagtggcttcactggaaaaatggtgtggctagcatttccctttgagtcatgatgacagatggtgtgaaaaccatctaagtttgcttttgaccatcacctcccagtagcaatttgctttcataatccatttagcaatccaggcctctgttgaaaagataatatgagggagaagggaacacatttccttctgaacttacttccctaagtcactttccttatgtatcatctaatacaatgatggttgagtgaaaatacagaaggggtgtttgagtattcagatttcataaaacacttccttggaatatagctgcattaacttggaaagaagcctgttgggccagaagacagaaactccaactggcaaaaaagcaagcatctaagaaaaaaaaccaccaaagttcttgaatttactatatttaaatgcattggttaagtttattttgctaaataaagtgaactgctttttgtctctaaaatgatattctaaataaaaccttaactttttgttgaagatgcactgaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:84525 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
GeneID:84525 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
GeneID:84525 -> Biological process: GO:0001829 [trophectodermal cell differentiation] evidence: IDA
GeneID:84525 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
GeneID:84525 -> Biological process: GO:0045596 [negative regulation of cell differentiation] evidence: IDA
GeneID:84525 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.