GGRNA Home | Help | Advanced search

2025-05-09 20:17:15, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001143832             672 bp    mRNA    linear   PRI 13-APR-2013
DEFINITION  Homo sapiens leucine twenty homeobox (LEUTX), mRNA.
ACCESSION   NM_001143832
VERSION     NM_001143832.1  GI:219802097
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 672)
  AUTHORS   Holland,P.W., Booth,H.A. and Bruford,E.A.
  TITLE     Classification and nomenclature of all human homeobox genes
  JOURNAL   BMC Biol. 5, 47 (2007)
   PUBMED   17963489
  REMARK    Publication Status: Online-Only
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH471126.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CR746510.1, H02655.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..672
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /map="19q13.2"
     gene            1..672
                     /gene="LEUTX"
                     /note="leucine twenty homeobox"
                     /db_xref="GeneID:342900"
                     /db_xref="HGNC:31953"
     exon            1..82
                     /gene="LEUTX"
                     /inference="alignment:Splign:1.39.8"
     variation       30
                     /gene="LEUTX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74763077"
     variation       31
                     /gene="LEUTX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148289253"
     variation       34
                     /gene="LEUTX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61732544"
     exon            83..234
                     /gene="LEUTX"
                     /inference="alignment:Splign:1.39.8"
     variation       101
                     /gene="LEUTX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17709621"
     variation       110
                     /gene="LEUTX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:117937250"
     CDS             166..672
                     /gene="LEUTX"
                     /note="putative leucine-twenty homeobox; arginine-fifty
                     homeobox-like pseudogene"
                     /codon_start=1
                     /product="leucine-twenty homeobox"
                     /protein_id="NP_001137304.1"
                     /db_xref="GI:219802098"
                     /db_xref="GeneID:342900"
                     /db_xref="HGNC:31953"
                     /translation="
MHPSLATMGKLASKLQLDLSVVKIWFKNQRAKWKRQQRQQMQTRPSLGPANQTTSVKKEETPSAITTANIRPVSPGISDANDHDLREPSGIKNPGGASASARVSSWDSQSYDIEQICLGASNPPWASTLFEIDEFVKIYDLPGEDDTSSLNQYLFPVCLEYDQLQSSV
"
     misc_feature    <166..243
                     /gene="LEUTX"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cl00084"
                     /db_xref="CDD:206827"
     variation       197
                     /gene="LEUTX"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:35726156"
     variation       226
                     /gene="LEUTX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:117228099"
     exon            235..672
                     /gene="LEUTX"
                     /inference="alignment:Splign:1.39.8"
     variation       277
                     /gene="LEUTX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:376692805"
     variation       320
                     /gene="LEUTX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:369685173"
     variation       377
                     /gene="LEUTX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373629971"
     variation       439
                     /gene="LEUTX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141754227"
     variation       459
                     /gene="LEUTX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147098601"
     variation       561
                     /gene="LEUTX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:376613498"
     variation       604
                     /gene="LEUTX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:61995735"
     variation       638
                     /gene="LEUTX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147692654"
     variation       654
                     /gene="LEUTX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377434841"
ORIGIN      
actgcacacggttttcagcctcatgcctccgtggaacctgcctgtcaggcgggcacctggaatctcaagcaactttctcaagaagggccaaggcgttatcgtcggccacgcacaagatttctctccaaacaactcacagcattgagagaattgcttgaaaagaccatgcacccaagtttggctacaatggggaaactggcttcaaagctacaacttgatctatccgtagtaaagatctggttcaagaaccagcgtgccaaatggaagaggcagcagcggcagcaaatgcagacacggccatcactagggccagcaaaccagacaacttcagtgaagaaggaggagactccctcagccataactactgcaaacattcgtccagtaagtcctggaatctctgatgcaaatgaccatgatctacgtgagccttctggtatcaagaatcctggaggagccagcgcctctgcgagggtttcatcctgggattctcagtcatatgacattgaacagatatgtctgggggcttcaaatcctccttgggcctccactctctttgaaatagatgaatttgtaaagatctatgacttgccaggggaagatgacaccagcagcctaaatcaatatctttttccagtatgccttgagtatgaccagctccaatcttcagtgtaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:342900 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:342900 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:342900 -> Cellular component: GO:0005634 [nucleus] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.