GGRNA Home | Help | Advanced search

2025-05-09 19:30:09, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001009812            1463 bp    mRNA    linear   PRI 18-APR-2013
DEFINITION  Homo sapiens ladybird homeobox 2 (LBX2), mRNA.
ACCESSION   NM_001009812 XM_376068
VERSION     NM_001009812.1  GI:57528436
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1463)
  AUTHORS   Chen,F., Collin,G.B., Liu,K.C., Beier,D.R., Eccles,M.,
            Nishina,P.M., Moshang,T. and Epstein,J.A.
  TITLE     Characterization of the murine Lbx2 promoter, identification of the
            human homologue, and evaluation as a candidate for Alstrom syndrome
  JOURNAL   Genomics 74 (2), 219-227 (2001)
   PUBMED   11386758
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AY305861.1.
            On Feb 20, 2005 this sequence version replaced gi:51460639.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY305861.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1463
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="2"
                     /map="2p13.1"
     gene            1..1463
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /note="ladybird homeobox 2"
                     /db_xref="GeneID:85474"
                     /db_xref="HGNC:15525"
                     /db_xref="HPRD:16235"
                     /db_xref="MIM:607164"
     exon            1..650
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(129..130)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:150475363"
     variation       complement(152)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:187387936"
     misc_feature    203..205
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /note="upstream in-frame stop codon"
     variation       complement(347)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373390422"
     variation       complement(368)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:73949673"
     variation       complement(382)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:13023123"
     CDS             458..1042
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /note="ladybird-like homeobox 2; lady bird-like homeobox
                     2; ladybird-like homeodomain protein 2; ladybird homeobox
                     protein homolog 2; ladybird homeobox homolog 2"
                     /codon_start=1
                     /product="transcription factor LBX2"
                     /protein_id="NP_001009812.1"
                     /db_xref="GI:57528437"
                     /db_xref="CCDS:CCDS33228.1"
                     /db_xref="GeneID:85474"
                     /db_xref="HGNC:15525"
                     /db_xref="HPRD:16235"
                     /db_xref="MIM:607164"
                     /translation="
MGKRTSLEVSLGELGGEKCRGGRRSFPPLAASRPARPGGWRWARRDLCKTASRAENNSQACRPQRRAGPDALGPGPFGRKRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRRAKLKRDVEEMRADVASLRALSPEVLCSLALPEGAPDPGLCLGPAGPDSRPHLSDEEIQVDD
"
     misc_feature    701..871
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(701..715,719..721,770..772,788..790,827..829,
                     833..838,845..850,854..862,866..871)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(707..709,716..718,836..838,845..850,857..859)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     variation       complement(468)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202062051"
     variation       complement(469)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142834208"
     variation       complement(486)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375023287"
     variation       complement(500)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200875884"
     variation       complement(518)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144712175"
     variation       complement(552)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149381878"
     variation       complement(554)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:144078336"
     variation       complement(563)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:138587545"
     variation       complement(585)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376381341"
     variation       complement(609)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373496462"
     exon            651..1452
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(659)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:184278980"
     variation       complement(757)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201038966"
     variation       complement(766)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12105316"
     variation       complement(785)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141126761"
     variation       complement(788)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:372670780"
     variation       complement(811)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140927750"
     variation       complement(880)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146479958"
     variation       complement(883)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:61998167"
     variation       complement(889)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139236519"
     variation       complement(896)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142324561"
     variation       complement(918)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17009998"
     variation       complement(921)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200697964"
     variation       complement(939)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149434729"
     variation       complement(942)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201094418"
     variation       complement(952)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6546908"
     variation       complement(956)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201832456"
     variation       complement(971)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143171761"
     variation       complement(983)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373555816"
     variation       complement(993)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199798817"
     variation       complement(999)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:369641153"
     variation       complement(1002)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145702468"
     variation       complement(1027)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144660513"
     variation       complement(1056)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370139978"
     variation       complement(1064)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:115466867"
     variation       complement(1066)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371290188"
     variation       complement(1067)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:114863168"
     variation       complement(1069)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201617763"
     variation       complement(1071)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369339716"
     variation       complement(1185)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370268201"
     variation       complement(1188)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:76278705"
     variation       complement(1346)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192872827"
     variation       complement(1379)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:188831634"
     variation       complement(1380..1381)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:199935347"
     variation       complement(1380)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:183874491"
     variation       complement(1424)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:193258880"
     variation       complement(1444)
                     /gene="LBX2"
                     /gene_synonym="LP3727"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:149693976"
ORIGIN      
gcactgcgtctcccaaggtggctgaagctggccagctgcgggctccgcgccgctcgtcccgggtctatgggtccattccccacgcccacccggaccccggggtcactcgggtctccgtctgtgccagggagggagaatcacgcccagggtcctctctggcttcgcgcgactgagaacgcgcccggacgcggcgcggcgctcctgagtcaaaggagaggtggcggcaggaccaccccagggcgccgtctgcacccccggacgcactcggccgtgctgcgcttccgggacaaggcgtcggttctcgcctgagggccaaaccttgcccctgcccaccttcctcacccccgccatttccaggactcacatccaaaggcgacagcaccaggatttgctcccgcctttggcacagaggaggacgggtccctctctcagcctggccagtctttcccagggcttgatgggaaaaaggacttccctagaagtgagtcttggggagttggggggagaaaagtgtcgaggagggcgtcggagtttcccaccgctggctgcttcccggcccgcacgcccgggagggtggcggtgggcgcgcagagatctttgcaaaacagcgtccagggcggaaaacaactcacaggcctgccgcccccaaaggcgggcaggtccggacgcgctgggccctggtcccttcggccgcaaacggcgcaagtcacgcactgcgttcaccgcgcaacaggtgctggagctggagcggcgcttcgtcttccagaagtacctggcgccgtccgagcgagacgggctagctacgcgactcggcctggccaacgcgcaggtggtcacttggttccagaaccggcgagccaagctcaagcgcgatgtggaggagatgcgcgccgacgtcgcctcgctacgcgcgttgtccccggaagtcctgtgcagcttagcactgcccgaaggcgctccagatcccggcctctgcctcggccctgccggccctgactcccggccccacctgtcagacgaggagatacaggtggacgattgaagacaaagccgccgccaatcctgggctctggggccctggactcctcacctcgcgctctgcctctggccagagttccagggtggaggaaggaggtccacttgggcctcttccggcccacagtccagacgctcacctttcccggtttttttgtaagtttgttttgttgtctgagacagggcctcgctctgtcgcccaggctggagtgccgtggagcgatcaccgctcactgcagtcgcgacctcctgggctcaagcgatcctcctgcctcaacctcccgactagctggcattacaggcgtgcagcaccaccccaggctaatttaaaaaacttttttttttagagaggaggtcccgctatgttgtccaggctactttcccaatatttgagaataaagtcgagactctgccgcaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:85474 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:85474 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:85474 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
            GeneID:85474 -> Cellular component: GO:0005634 [nucleus] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.