Home |
Help |
Advanced search
2025-05-09 19:52:15, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_000956 2494 bp mRNA linear PRI 26-MAY-2013
DEFINITION Homo sapiens prostaglandin E receptor 2 (subtype EP2), 53kDa
(PTGER2), mRNA.
ACCESSION NM_000956
VERSION NM_000956.3 GI:194473721
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2494)
AUTHORS Hu,S., Sun,W., Wei,W., Wang,D., Jin,J., Wu,J., Chen,J., Wu,H. and
Wang,Q.
TITLE Involvement of the prostaglandin E receptor EP2 in
paeoniflorin-induced human hepatoma cell apoptosis
JOURNAL Anticancer Drugs 24 (2), 140-149 (2013)
PUBMED 23069790
REMARK GeneRIF: The expression of the EP2 receptor and Bcl-2 was
significantly increased.
REFERENCE 2 (bases 1 to 2494)
AUTHORS Wildenhain,S., Ingenhag,D., Ruckert,C., Degistirici,O., Dugas,M.,
Meisel,R., Hauer,J. and Borkhardt,A.
TITLE Homeobox protein HB9 binds to the prostaglandin E receptor 2
promoter and inhibits intracellular cAMP mobilization in leukemic
cells
JOURNAL J. Biol. Chem. 287 (48), 40703-40712 (2012)
PUBMED 23048027
REMARK GeneRIF: HB9 binds to the prostaglandin E receptor 2 promoter and
inhibits intracellular cAMP mobilization in leukemic cells.
REFERENCE 3 (bases 1 to 2494)
AUTHORS To,S.Q., Takagi,K., Miki,Y., Suzuki,K., Abe,E., Yang,Y., Sasano,H.,
Simpson,E.R., Knower,K.C. and Clyne,C.D.
TITLE Epigenetic mechanisms regulate the prostaglandin E receptor 2 in
breast cancer
JOURNAL J. Steroid Biochem. Mol. Biol. 132 (3-5), 331-338 (2012)
PUBMED 22929011
REMARK GeneRIF: Although EP2 methylation status is inversely correlated to
expression levels in established breast cancer cell lines, we could
not identify that such a correlation existed in tumour-associated
stroma cells.
REFERENCE 4 (bases 1 to 2494)
AUTHORS Desai,S., April,H., Nwaneshiudu,C. and Ashby,B.
TITLE Comparison of agonist-induced internalization of the human EP2 and
EP4 prostaglandin receptors: role of the carboxyl terminus in EP4
receptor sequestration
JOURNAL Mol. Pharmacol. 58 (6), 1279-1286 (2000)
PUBMED 11093764
REFERENCE 5 (bases 1 to 2494)
AUTHORS Smock,S.L., Pan,L.C., Castleberry,T.A., Lu,B., Mather,R.J. and
Owen,T.A.
TITLE Cloning, structural characterization, and chromosomal localization
of the gene encoding the human prostaglandin E(2) receptor EP2
subtype
JOURNAL Gene 237 (2), 393-402 (1999)
PUBMED 10521663
REFERENCE 6 (bases 1 to 2494)
AUTHORS Stillman,B.A., Breyer,M.D. and Breyer,R.M.
TITLE Importance of the extracellular domain for prostaglandin EP(2)
receptor function
JOURNAL Mol. Pharmacol. 56 (3), 545-551 (1999)
PUBMED 10462542
REFERENCE 7 (bases 1 to 2494)
AUTHORS Duncan,A.M., Anderson,L.L., Funk,C.D., Abramovitz,M. and Adam,M.
TITLE Chromosomal localization of the human prostanoid receptor gene
family
JOURNAL Genomics 25 (3), 740-742 (1995)
PUBMED 7759114
REFERENCE 8 (bases 1 to 2494)
AUTHORS Regan,J.W., Bailey,T.J., Pepperl,D.J., Pierce,K.L., Bogardus,A.M.,
Donello,J.E., Fairbairn,C.E., Kedzie,K.M., Woodward,D.F. and
Gil,D.W.
TITLE Cloning of a novel human prostaglandin receptor with
characteristics of the pharmacologically defined EP2 subtype
JOURNAL Mol. Pharmacol. 46 (2), 213-220 (1994)
PUBMED 8078484
REFERENCE 9 (bases 1 to 2494)
AUTHORS Bastien,L., Sawyer,N., Grygorczyk,R., Metters,K.M. and Adam,M.
TITLE Cloning, functional expression, and characterization of the human
prostaglandin E2 receptor EP2 subtype
JOURNAL J. Biol. Chem. 269 (16), 11873-11877 (1994)
PUBMED 8163486
REFERENCE 10 (bases 1 to 2494)
AUTHORS An,S., Yang,J., Xia,M. and Goetzl,E.J.
TITLE Cloning and expression of the EP2 subtype of human receptors for
prostaglandin E2
JOURNAL Biochem. Biophys. Res. Commun. 197 (1), 263-270 (1993)
PUBMED 8250933
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from CR977661.1, CN484094.1,
BC093927.1, CF132756.1, BE739744.1, U19487.1 and BM986745.1.
This sequence is a reference standard in the RefSeqGene project.
On Jul 26, 2008 this sequence version replaced gi:31881629.
Summary: This gene encodes a receptor for prostaglandin E2, a
metabolite of arachidonic acid which has different biologic
activities in a wide range of tissues. Mutations in this gene are
associated with aspirin-induced susceptibility to asthma. [provided
by RefSeq, Oct 2009].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: U19487.1, BC093927.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025084 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-179 CR977661.1 1-179
180-325 CN484094.1 157-302
326-1411 BC093927.1 128-1213
1412-1536 CF132756.1 184-308
1537-1770 BE739744.1 19-252 c
1771-2090 U19487.1 1676-1995
2091-2494 BM986745.1 1-404 c
FEATURES Location/Qualifiers
source 1..2494
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="14"
/map="14q22"
gene 1..2494
/gene="PTGER2"
/gene_synonym="EP2"
/note="prostaglandin E receptor 2 (subtype EP2), 53kDa"
/db_xref="GeneID:5732"
/db_xref="HGNC:9594"
/db_xref="HPRD:08905"
/db_xref="MIM:176804"
exon 1..1094
/gene="PTGER2"
/gene_synonym="EP2"
/inference="alignment:Splign:1.39.8"
variation 86
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1353411"
misc_feature 162..164
/gene="PTGER2"
/gene_synonym="EP2"
/note="upstream in-frame stop codon"
variation 180
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1254598"
STS 199..1411
/gene="PTGER2"
/gene_synonym="EP2"
/db_xref="UniSTS:484297"
variation 218
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:367906865"
variation 251
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:377586161"
CDS 252..1328
/gene="PTGER2"
/gene_synonym="EP2"
/note="prostanoid EP2 receptor; PGE receptor EP2 subtype;
PGE2 receptor EP2 subtype"
/codon_start=1
/product="prostaglandin E2 receptor EP2 subtype"
/protein_id="NP_000947.2"
/db_xref="GI:31881630"
/db_xref="CCDS:CCDS9708.1"
/db_xref="GeneID:5732"
/db_xref="HGNC:9594"
/db_xref="HPRD:08905"
/db_xref="MIM:176804"
/translation="
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
"
misc_feature 321..392
/gene="PTGER2"
/gene_synonym="EP2"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P43116.2);
transmembrane region"
misc_feature 432..1193
/gene="PTGER2"
/gene_synonym="EP2"
/note="7 transmembrane receptor (rhodopsin family);
Region: 7tm_1; pfam00001"
/db_xref="CDD:200918"
misc_feature 447..524
/gene="PTGER2"
/gene_synonym="EP2"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P43116.2);
transmembrane region"
misc_feature 585..647
/gene="PTGER2"
/gene_synonym="EP2"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P43116.2);
transmembrane region"
misc_feature 705..779
/gene="PTGER2"
/gene_synonym="EP2"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P43116.2);
transmembrane region"
misc_feature 846..920
/gene="PTGER2"
/gene_synonym="EP2"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P43116.2);
transmembrane region"
misc_feature 1038..1109
/gene="PTGER2"
/gene_synonym="EP2"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P43116.2);
transmembrane region"
misc_feature 1149..1220
/gene="PTGER2"
/gene_synonym="EP2"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P43116.2);
transmembrane region"
variation 252
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:369088393"
variation 278
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:373293918"
variation 283
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:143842615"
variation 284
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:200159674"
variation 326
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1353410"
variation 371
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:140005651"
variation 385
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:371237403"
variation 403
/gene="PTGER2"
/gene_synonym="EP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:149858582"
variation 430
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:139726427"
variation 434
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:373886710"
variation 447
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:199970087"
variation 458
/gene="PTGER2"
/gene_synonym="EP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:376819687"
variation 467
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:143268571"
variation 468
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:371082222"
variation 491
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:146696779"
variation 498
/gene="PTGER2"
/gene_synonym="EP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:111965614"
variation 563
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:142520476"
variation 587
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:151002714"
variation 657
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:140871944"
variation 744
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:150176330"
variation 788
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:138820478"
variation 797
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:141336040"
variation 799
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:147051461"
variation 864
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:200859761"
variation 875
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:200194449"
variation 879
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:138405848"
variation 898
/gene="PTGER2"
/gene_synonym="EP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:199670925"
variation 917
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:143806281"
variation 918
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:368578200"
variation 921
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:201355660"
variation 928..929
/gene="PTGER2"
/gene_synonym="EP2"
/replace=""
/replace="c"
/db_xref="dbSNP:377257557"
variation 928
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:77558975"
variation 966
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:112051607"
variation 975
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:144220413"
variation 997
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:199687826"
variation 1022
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:61757786"
variation 1028
/gene="PTGER2"
/gene_synonym="EP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:200330886"
variation 1037
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:148307308"
variation 1061
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:34414213"
exon 1095..2480
/gene="PTGER2"
/gene_synonym="EP2"
/inference="alignment:Splign:1.39.8"
variation 1105
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:139552094"
variation 1118
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:45478594"
variation 1142
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:144210519"
variation 1163
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2229187"
variation 1167
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:200776840"
variation 1169
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:60167547"
variation 1193
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:181468557"
variation 1202
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:372997180"
variation 1205
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:377525620"
variation 1276
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:149912921"
variation 1278
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:111527326"
variation 1288
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:367922312"
variation 1340
/gene="PTGER2"
/gene_synonym="EP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:199599262"
variation 1390
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:708502"
variation 1415
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:148744234"
variation 1442
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:371901911"
STS 1449..1639
/gene="PTGER2"
/gene_synonym="EP2"
/standard_name="G59837"
/db_xref="UniSTS:136986"
variation 1537
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:17197"
variation 1573
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:45472599"
STS 1631..1965
/gene="PTGER2"
/gene_synonym="EP2"
/standard_name="SHGC-12634"
/db_xref="UniSTS:58544"
variation 1859
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:142305426"
variation 1996
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:186059271"
variation 2015
/gene="PTGER2"
/gene_synonym="EP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:45501991"
variation 2056
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:45461592"
variation 2089..2092
/gene="PTGER2"
/gene_synonym="EP2"
/replace=""
/replace="ttta"
/db_xref="dbSNP:35932603"
variation 2090..2093
/gene="PTGER2"
/gene_synonym="EP2"
/replace=""
/replace="ttat"
/db_xref="dbSNP:45460603"
variation 2190
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:189260273"
variation 2256
/gene="PTGER2"
/gene_synonym="EP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1042618"
variation 2355..2358
/gene="PTGER2"
/gene_synonym="EP2"
/replace=""
/replace="tgtt"
/db_xref="dbSNP:368242759"
variation 2432
/gene="PTGER2"
/gene_synonym="EP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:181203428"
polyA_signal 2453..2458
/gene="PTGER2"
/gene_synonym="EP2"
polyA_site 2480
/gene="PTGER2"
/gene_synonym="EP2"
ORIGIN
cggccttggccggcgcgggtaggcgcgggagcctcgagcgccgctcggatgcagcagccgagccgccactcggcgcgcggcgggagacccagggcaagccgccgtcggcgcgctgggtgcgggaagggggctctggatttcggtccctcccctttttcctctgagtctcggaacgctccggctctcagaccctcttcctcccaggtaaaggccgggagaggagggcgcatctcttttccaggcaccccaccatgggcaatgcctccaatgactcccagtctgaggactgcgagacgcgacagtggcttcccccaggcgaaagcccagccatcagctccgtcatgttctcggccggggtgctggggaacctcatagcactggcgctgctggcgcgccgctggcggggggacgtggggtgcagcgccggccgcaggagctccctctccttgttccacgtgctggtgaccgagctggtgttcaccgacctgctcgggacctgcctcatcagcccagtggtactggcttcgtacgcgcggaaccagaccctggtggcactggcgcccgagagccgcgcgtgcacctacttcgctttcgccatgaccttcttcagcctggccacgatgctcatgctcttcgccatggccctggagcgctacctctcgatcgggcacccctacttctaccagcgccgcgtctcgcgctccgggggcctggccgtgctgcctgtcatctatgcagtctccctgctcttctgctcgctgccgctgctggactatgggcagtacgtccagtactgccccgggacctggtgcttcatccggcacgggcggaccgcttacctgcagctgtacgccaccctgctgctgcttctcattgtctcggtgctcgcctgcaacttcagtgtcattctcaacctcatccgcatgcaccgccgaagccggagaagccgctgcggaccttccctgggcagtggccggggcggccccggggcccgcaggagaggggaaagggtgtccatggcggaggagacggaccacctcattctcctggctatcatgaccatcaccttcgccgtctgctccttgcctttcacgatttttgcatatatgaatgaaacctcttcccgaaaggaaaaatgggacctccaagctcttaggtttttatcaattaattcaataattgacccttgggtctttgccatccttaggcctcctgttctgagactaatgcgttcagtcctctgttgtcggatttcattaagaacacaagatgcaacacaaacttcctgttctacacagtcagatgccagtaaacaggctgacctttgaggtcagtagtttaaaagttcttagttatatagcatctggaagatcattttgaaattgttccttggagaaatgaaaacagtgtgtaaacaaaatgaagctgccctaataaaaaggagtatacaaacatttaagctgtggtcaaggctacagatgtgctgacaaggcacttcatgtaaagtgtcagaaggagctacaaaacctaccctcagtgagcatggtacttggcctttggaggaacaatcggctgcattgaagatccagctgcctattgatttaagctttcctgttgaatgacaaagtatgtggttttgtaatttgtttgaaaccccaaacagtgactgtactttctattttaatcttgctactaccgttatacacatatagtgtacagccagaccagattaaacttcatatgtaatctctaggaagtcaatatgtggaagcaaccaagcctgctgtcttgtgatcacttagcgaaccctttatttgaacaatgaagttgaaaatcataggcaccttttactgtgatgtttgtgtatgtgggagtactctcatcactacagtattactcttacaagagtggactcagtgggttaacatcagttttgtttactcatcctccaggaactgcaggtcaagttgtcaggttatttattttataatgtccatatgctaatagtgatcaagaagactttaggaatggttctctcaacaagaaataatagaaatgtctcaaggcagttaattctcattaatactctttatttatcctatttctgggggaggatgtacgtggccatgtatgaagccaaatattaggcttaaaaactgaaaaatctggttcattcttcagatatactggaacccttttaaagttgatattggggccatgagtaaaatagattttataagatgactgtgttgtaccaaaattcatctgtctatattttatttagggaacatggtttgactcatcttatatgggaaaccatgtagcagtgagtcatatcttaatatatttctaaatgtttggcatgtaaatgtaaactcagcatcaaaatatttcagtgaatttgcactgtttaatcatagttactgtgtaaactcatctgaaatgttacaaaaataaactataaaacaaaaatttgaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:5732 -> Molecular function: GO:0004957 [prostaglandin E receptor activity] evidence: IEA
GeneID:5732 -> Biological process: GO:0007186 [G-protein coupled receptor signaling pathway] evidence: TAS
GeneID:5732 -> Biological process: GO:0007189 [adenylate cyclase-activating G-protein coupled receptor signaling pathway] evidence: ISS
GeneID:5732 -> Biological process: GO:0032496 [response to lipopolysaccharide] evidence: IEA
GeneID:5732 -> Biological process: GO:0042127 [regulation of cell proliferation] evidence: IEA
GeneID:5732 -> Biological process: GO:0071380 [cellular response to prostaglandin E stimulus] evidence: ISS
GeneID:5732 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS
GeneID:5732 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.