Home |
Help |
Advanced search
2025-05-09 19:13:04, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_000209 2573 bp mRNA linear PRI 13-APR-2013 DEFINITION Homo sapiens pancreatic and duodenal homeobox 1 (PDX1), mRNA. ACCESSION NM_000209 NM_013311 VERSION NM_000209.3 GI:189095257 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2573) AUTHORS Igarashi,S., Matsubara,T., Harada,K., Ikeda,H., Sato,Y., Sasaki,M., Matsui,O. and Nakanuma,Y. TITLE Bile duct expression of pancreatic and duodenal homeobox 1 in perihilar cholangiocarcinogenesis JOURNAL Histopathology 61 (2), 266-276 (2012) PUBMED 22594685 REMARK GeneRIF: Up-regulation of Pdx1 is a feature of cholangiocarcinogenesis associated with chronic cholangitis. REFERENCE 2 (bases 1 to 2573) AUTHORS Chen,C., Fang,R., Chou,L.C., Lowe,A.W. and Sibley,E. TITLE PDX1 regulation of FABP1 and novel target genes in human intestinal epithelial Caco-2 cells JOURNAL Biochem. Biophys. Res. Commun. 423 (1), 183-187 (2012) PUBMED 22640736 REMARK GeneRIF: PDX1 repression of FABP1, LCT, and SI suggests a role for PDX1 in patterning anterior intestinal development. REFERENCE 3 (bases 1 to 2573) AUTHORS Manning,A.K., Hivert,M.F., Scott,R.A., Grimsby,J.L., Bouatia-Naji,N., Chen,H., Rybin,D., Liu,C.T., Bielak,L.F., Prokopenko,I., Amin,N., Barnes,D., Cadby,G., Hottenga,J.J., Ingelsson,E., Jackson,A.U., Johnson,T., Kanoni,S., Ladenvall,C., Lagou,V., Lahti,J., Lecoeur,C., Liu,Y., Martinez-Larrad,M.T., Montasser,M.E., Navarro,P., Perry,J.R., Rasmussen-Torvik,L.J., Salo,P., Sattar,N., Shungin,D., Strawbridge,R.J., Tanaka,T., van Duijn,C.M., An,P., de Andrade,M., Andrews,J.S., Aspelund,T., Atalay,M., Aulchenko,Y., Balkau,B., Bandinelli,S., Beckmann,J.S., Beilby,J.P., Bellis,C., Bergman,R.N., Blangero,J., Boban,M., Boehnke,M., Boerwinkle,E., Bonnycastle,L.L., Boomsma,D.I., Borecki,I.B., Bottcher,Y., Bouchard,C., Brunner,E., Budimir,D., Campbell,H., Carlson,O., Chines,P.S., Clarke,R., Collins,F.S., Corbaton-Anchuelo,A., Couper,D., de Faire,U., Dedoussis,G.V., Deloukas,P., Dimitriou,M., Egan,J.M., Eiriksdottir,G., Erdos,M.R., Eriksson,J.G., Eury,E., Ferrucci,L., Ford,I., Forouhi,N.G., Fox,C.S., Franzosi,M.G., Franks,P.W., Frayling,T.M., Froguel,P., Galan,P., de Geus,E., Gigante,B., Glazer,N.L., Goel,A., Groop,L., Gudnason,V., Hallmans,G., Hamsten,A., Hansson,O., Harris,T.B., Hayward,C., Heath,S., Hercberg,S., Hicks,A.A., Hingorani,A., Hofman,A., Hui,J., Hung,J., Jarvelin,M.R., Jhun,M.A., Johnson,P.C., Jukema,J.W., Jula,A., Kao,W.H., Kaprio,J., Kardia,S.L., Keinanen-Kiukaanniemi,S., Kivimaki,M., Kolcic,I., Kovacs,P., Kumari,M., Kuusisto,J., Kyvik,K.O., Laakso,M., Lakka,T., Lannfelt,L., Lathrop,G.M., Launer,L.J., Leander,K., Li,G., Lind,L., Lindstrom,J., Lobbens,S., Loos,R.J., Luan,J., Lyssenko,V., Magi,R., Magnusson,P.K., Marmot,M., Meneton,P., Mohlke,K.L., Mooser,V., Morken,M.A., Miljkovic,I., Narisu,N., O'Connell,J., Ong,K.K., Oostra,B.A., Palmer,L.J., Palotie,A., Pankow,J.S., Peden,J.F., Pedersen,N.L., Pehlic,M., Peltonen,L., Penninx,B., Pericic,M., Perola,M., Perusse,L., Peyser,P.A., Polasek,O., Pramstaller,P.P., Province,M.A., Raikkonen,K., Rauramaa,R., Rehnberg,E., Rice,K., Rotter,J.I., Rudan,I., Ruokonen,A., Saaristo,T., Sabater-Lleal,M., Salomaa,V., Savage,D.B., Saxena,R., Schwarz,P., Seedorf,U., Sennblad,B., Serrano-Rios,M., Shuldiner,A.R., Sijbrands,E.J., Siscovick,D.S., Smit,J.H., Small,K.S., Smith,N.L., Smith,A.V., Stancakova,A., Stirrups,K., Stumvoll,M., Sun,Y.V., Swift,A.J., Tonjes,A., Tuomilehto,J., Trompet,S., Uitterlinden,A.G., Uusitupa,M., Vikstrom,M., Vitart,V., Vohl,M.C., Voight,B.F., Vollenweider,P., Waeber,G., Waterworth,D.M., Watkins,H., Wheeler,E., Widen,E., Wild,S.H., Willems,S.M., Willemsen,G., Wilson,J.F., Witteman,J.C., Wright,A.F., Yaghootkar,H., Zelenika,D., Zemunik,T., Zgaga,L., Wareham,N.J., McCarthy,M.I., Barroso,I., Watanabe,R.M., Florez,J.C., Dupuis,J., Meigs,J.B. and Langenberg,C. CONSRTM DIAbetes Genetics Replication And Meta-analysis (DIAGRAM) Consortium; Multiple Tissue Human Expression Resource (MUTHER) Consortium TITLE A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance JOURNAL Nat. Genet. 44 (6), 659-669 (2012) PUBMED 22581228 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 2573) AUTHORS Liu,S.H., Rao,D.D., Nemunaitis,J., Senzer,N., Zhou,G., Dawson,D., Gingras,M.C., Wang,Z., Gibbs,R., Norman,M., Templeton,N.S., Demayo,F.J., O'Malley,B., Sanchez,R., Fisher,W.E. and Brunicardi,F.C. TITLE PDX-1 is a therapeutic target for pancreatic cancer, insulinoma and islet neoplasia using a novel RNA interference platform JOURNAL PLoS ONE 7 (8), E40452 (2012) PUBMED 22905092 REMARK GeneRIF: PDX-1 is a therapeutic target for both hormonal symptoms and tumor volume in models of pancreatic cancer, insulinoma and islet neoplasia REFERENCE 5 (bases 1 to 2573) AUTHORS Guo,Q.S., Zhu,M.Y., Wang,L., Fan,X.J., Lu,Y.H., Wang,Z.W., Zhu,S.J., Wang,Y. and Huang,Y. TITLE Combined transfection of the three transcriptional factors, PDX-1, NeuroD1, and MafA, causes differentiation of bone marrow mesenchymal stem cells into insulin-producing cells JOURNAL Exp Diabetes Res 2012, 672013 (2012) PUBMED 22761608 REMARK GeneRIF: Combined transfection of the three transcriptional factors, PDX-1, NeuroD1, and MafA, causes differentiation of bone marrow mesenchymal stem cells into insulin-producing cells REFERENCE 6 (bases 1 to 2573) AUTHORS Watada,H., Kajimoto,Y., Kaneto,H., Matsuoka,T., Fujitani,Y., Miyazaki,Ji. and Yamasaki,Y. TITLE Involvement of the homeodomain-containing transcription factor PDX-1 in islet amyloid polypeptide gene transcription JOURNAL Biochem. Biophys. Res. Commun. 229 (3), 746-751 (1996) PUBMED 8954967 REFERENCE 7 (bases 1 to 2573) AUTHORS Waeber,G., Thompson,N., Nicod,P. and Bonny,C. TITLE Transcriptional activation of the GLUT2 gene by the IPF-1/STF-1/IDX-1 homeobox factor JOURNAL Mol. Endocrinol. 10 (11), 1327-1334 (1996) PUBMED 8923459 REFERENCE 8 (bases 1 to 2573) AUTHORS Inoue,H., Riggs,A.C., Tanizawa,Y., Ueda,K., Kuwano,A., Liu,L., Donis-Keller,H. and Permutt,M.A. TITLE Isolation, characterization, and chromosomal mapping of the human insulin promoter factor 1 (IPF-1) gene JOURNAL Diabetes 45 (6), 789-794 (1996) PUBMED 8635654 REFERENCE 9 (bases 1 to 2573) AUTHORS Stoffel,M., Stein,R., Wright,C.V., Espinosa,R. III, Le Beau,M.M. and Bell,G.I. TITLE Localization of human homeodomain transcription factor insulin promoter factor 1 (IPF1) to chromosome band 13q12.1 JOURNAL Genomics 28 (1), 125-126 (1995) PUBMED 7590740 REFERENCE 10 (bases 1 to 2573) AUTHORS Leonard,J., Peers,B., Johnson,T., Ferreri,K., Lee,S. and Montminy,M.R. TITLE Characterization of somatostatin transactivating factor-1, a novel homeobox factor that stimulates somatostatin expression in pancreatic islet cells JOURNAL Mol. Endocrinol. 7 (10), 1275-1283 (1993) PUBMED 7505393 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA848737.1, U30329.1 and AL353195.14. This sequence is a reference standard in the RefSeqGene project. On May 28, 2008 this sequence version replaced gi:119392075. Summary: The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4). [provided by RefSeq, Jul 2008]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: CA848737.1, X99894.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-570 CA848737.1 1-570 571-1516 U30329.1 483-1428 1517-2573 AL353195.14 13760-14816 FEATURES Location/Qualifiers source 1..2573 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="13" /map="13q12.1" gene 1..2573 /gene="PDX1" /gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1; STF-1" /note="pancreatic and duodenal homeobox 1" /db_xref="GeneID:3651" /db_xref="HGNC:6107" /db_xref="HPRD:02843" /db_xref="MIM:600733" exon 1..514 /gene="PDX1" /gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1; STF-1" /inference="alignment:Splign:1.39.8" variation 4 /gene="PDX1" /gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1; STF-1" /replace="" /replace="t" /db_xref="dbSNP:201066590" STS 18..1010 /gene="PDX1" /gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1; STF-1" /db_xref="UniSTS:483240" STS 20..162 /gene="PDX1" /gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1; STF-1" /standard_name="G05158" /db_xref="UniSTS:3169" variation 23 /gene="PDX1" /gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1; STF-1" /replace="g" /replace="t" /db_xref="dbSNP:188482874" variation 86..87 /gene="PDX1" /gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1; STF-1" /replace="" /replace="ctcccgg" /db_xref="dbSNP:193922352" variation 91 /gene="PDX1" /gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1; STF-1" /replace="c" /replace="t" /db_xref="dbSNP:193922351" CDS 109..960 /gene="PDX1" /gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1; STF-1" /note="pancreatic-duodenal homeobox factor 1; somatostatin transcription factor 1; insulin promoter factor 1, homeodomain transcription factor; insulin upstream factor 1; glucose-sensitive factor; IPF-1; IUF-1; islet/duodenum homeobox-1; somatostatin-transactivating factor 1" /codon_start=1 /product="pancreas/duodenum homeobox protein 1" /protein_id="NP_000200.1" /db_xref="GI:4557673" /db_xref="CCDS:CCDS9327.1" /db_xref="GeneID:3651" /db_xref="HGNC:6107" /db_xref="HPRD:02843" /db_xref="MIM:600733" /translation="
MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPPPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEPR
"
misc_feature 145..327
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P52945.1);
Region: Transactivation domain (By similarity)"
misc_feature 460..477
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P52945.1);
Region: Antp-type hexapeptide"
misc_feature 547..723
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/note="Homeodomain; DNA binding domains involved in the
transcriptional regulation of key eukaryotic developmental
processes; may bind to DNA as monomers or as homo- and/or
heterodimers, in a sequence-specific manner; Region:
homeodomain; cd00086"
/db_xref="CDD:28970"
misc_feature order(547..561,565..567,616..618,634..636,673..675,
679..684,691..696,700..708,712..717)
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/note="DNA binding site [nucleotide binding]"
/db_xref="CDD:28970"
misc_feature order(553..555,562..564,682..684,691..696,703..705)
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/note="specific DNA base contacts [nucleotide binding];
other site"
/db_xref="CDD:28970"
misc_feature 697..717
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P52945.1);
Region: Nuclear localization signal (By similarity)"
misc_feature 910..912
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by HIPK2; propagated from
UniProtKB/Swiss-Prot (P52945.1); phosphorylation site"
variation 114
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:146936598"
variation 160
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:137852785"
variation 205
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="c"
/db_xref="dbSNP:192902098"
variation 270
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:28509441"
variation 284
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="t"
/db_xref="dbSNP:137852784"
variation 296
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace=""
/replace="c"
/db_xref="dbSNP:193929377"
variation 324
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:193922353"
variation 334
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:137852783"
variation 392
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="c"
/db_xref="dbSNP:375009107"
variation 426
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="g"
/replace="t"
/db_xref="dbSNP:193922354"
variation 429
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="c"
/db_xref="dbSNP:201701313"
variation 444
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="g"
/db_xref="dbSNP:149275902"
exon 515..2573
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/inference="alignment:Splign:1.39.8"
variation 526
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:143517122"
variation 537
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="g"
/db_xref="dbSNP:148001995"
variation 550
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="g"
/db_xref="dbSNP:193922355"
variation 600
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="g"
/replace="t"
/db_xref="dbSNP:80356661"
variation 640
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:80356662"
variation 641
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:387906777"
variation 645
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:200760158"
variation 651
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:75498935"
variation 653
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:369507870"
variation 662
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="g"
/replace="t"
/db_xref="dbSNP:202159230"
variation 679
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="c"
/db_xref="dbSNP:193922356"
variation 698
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:137852786"
variation 767
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="t"
/db_xref="dbSNP:201343646"
variation 769
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:150559931"
variation 772
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:368507502"
variation 778
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:137852787"
variation 787
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:372765489"
variation 801
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:200411304"
variation 802
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:367625089"
variation 805
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="g"
/replace="t"
/db_xref="dbSNP:371525768"
variation 824
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="c"
/db_xref="dbSNP:199644078"
variation 833
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:193922358"
variation 834..835
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace=""
/replace="ccg"
/db_xref="dbSNP:193922357"
variation 836..837
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace=""
/replace="gcc"
/db_xref="dbSNP:193922359"
variation 865
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:370787126"
variation 881
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:193922360"
variation 1028
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:374397203"
variation 1048
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:17847223"
variation 1177
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace=""
/replace="a"
/db_xref="dbSNP:55957037"
variation 1243..1244
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace=""
/replace="ggggg"
/replace="ggggggggg"
/db_xref="dbSNP:141044960"
STS 1262..1414
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/standard_name="RH79140"
/db_xref="UniSTS:37111"
variation 1523..1524
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace=""
/replace="tct"
/db_xref="dbSNP:200414219"
variation 1528
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace=""
/replace="c"
/db_xref="dbSNP:372179991"
variation 1602..1603
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace=""
/replace="tct"
/db_xref="dbSNP:113506161"
variation 1608..1610
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace=""
/replace="tcc"
/db_xref="dbSNP:201597488"
variation 1703..1732
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace=""
/replace="tccccctcctctccctcctcctcttcttct"
/db_xref="dbSNP:373152010"
variation 1703
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="t"
/db_xref="dbSNP:71433245"
variation 1706..1714
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace=""
/replace="ccctcctct"
/db_xref="dbSNP:139276646"
variation 1724..1726
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace=""
/replace="tct"
/db_xref="dbSNP:201227980"
variation 1741
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:11617235"
variation 1754
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:143062765"
variation 1796
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="g"
/replace="t"
/db_xref="dbSNP:11617238"
variation 1804
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:190800391"
variation 1805
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:374204593"
variation 1811
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:11617239"
variation 1812..1814
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace=""
/replace="tcc"
/db_xref="dbSNP:71993976"
variation 1814..1816
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace=""
/replace="ctc"
/db_xref="dbSNP:60008665"
variation 1817
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:11620272"
variation 1822..1823
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace=""
/replace="ttcttctccctcctcttcctcctc"
/db_xref="dbSNP:371209265"
variation 1823
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:74799049"
variation 1831
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:78382412"
variation 1833
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:11620280"
variation 1839
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="t"
/db_xref="dbSNP:147791430"
variation 1841
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:12560601"
variation 1863
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="t"
/db_xref="dbSNP:9554205"
variation 1975
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:112637982"
variation 1982
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="t"
/db_xref="dbSNP:112525679"
variation 1993
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="t"
/db_xref="dbSNP:74905790"
variation 2000
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:75697516"
variation 2084
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:7981781"
variation 2180
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:112431822"
variation 2198
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:113931775"
variation 2302
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:9319402"
variation 2315
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="g"
/db_xref="dbSNP:113776422"
variation 2395
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:183052606"
variation 2417
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:112640306"
variation 2448
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="a"
/replace="c"
/db_xref="dbSNP:187952798"
polyA_signal 2454..2459
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
variation 2469
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="g"
/replace="t"
/db_xref="dbSNP:75445448"
polyA_site 2490
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
polyA_signal 2550..2555
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
variation 2560
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:112632160"
variation 2562..2563
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
/replace=""
/replace="tgttt"
/db_xref="dbSNP:372475223"
polyA_site 2573
/gene="PDX1"
/gene_synonym="GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1;
STF-1"
ORIGIN
gggtggcgccgggagtgggaacgccacacagtgccaaatccccggctccagctcccgactcccggctcccggctcccggctcccggtgcccaatcccgggccgcagccatgaacggcgaggagcagtactacgcggccacgcagctttacaaggacccatgcgcgttccagcgaggcccggcgccggagttcagcgccagcccccctgcgtgcctgtacatgggccgccagcccccgccgccgccgccgcacccgttccctggcgccctgggcgcgctggagcagggcagccccccggacatctccccgtacgaggtgccccccctcgccgacgaccccgcggtggcgcaccttcaccaccacctcccggctcagctcgcgctcccccacccgcccgccgggcccttcccggagggagccgagccgggcgtcctggaggagcccaaccgcgtccagctgcctttcccatggatgaagtctaccaaagctcacgcgtggaaaggccagtgggcaggcggcgcctacgctgcggagccggaggagaacaagcggacgcgcacggcctacacgcgcgcacagctgctagagctggagaaggagttcctattcaacaagtacatctcacggccgcgccgggtggagctggctgtcatgttgaacttgaccgagagacacatcaagatctggttccaaaaccgccgcatgaagtggaaaaaggaggaggacaagaagcgcggcggcgggacagctgtcgggggtggcggggtcgcggagcctgagcaggactgcgccgtgacctccggcgaggagcttctggcgctgccgccgccgccgccccccggaggtgctgtgccgcccgctgcccccgttgccgcccgagagggccgcctgccgcctggccttagcgcgtcgccacagccctccagcgtcgcgcctcggcggccgcaggaaccacgatgagaggcaggagctgctcctggctgaggggcttcaaccactcgccgaggaggagcagagggcctaggaggaccccgggcgtggaccacccgccctggcagttgaatggggcggcaattgcggggcccaccttagaccgaaggggaaaacccgctctctcaggcgcatgtgccagttggggccccgcgggtagatgccggcaggccttccggaagaaaaagagccattggtttttgtagtattggggccctcttttagtgatactggattggcgttgtttgtggctgttgcgcacatccctgccctcctacagcactccaccttgggacctgtttagagaagccggctcttcaaagacaatggaaactgtaccatacacattggaaggctccctaacacacacagcggggaagctgggccgagtaccttaatctgccataaagccattcttactcgggcgacccctttaagtttagaaataattgaaaggaaatgtttgagttttcaaagatcccgtgaaattgatgccagtggaatacagtgagtcctcctcttcctcctcctcctcttccccctccccttcctcctcctcctcttcttttccctcctcttcctcttcctcctgctctcctttcctccccctcctcttttccctcctcttcctcttcctcctgctctcctttcctccccctcctctttctcctcctcctcctcttcttccccctcctctccctcctcctcttcttccccctcctctccctcctcctcttcttctccctcctcttcctcttcctcctcttccacgtgctctcctttcctccccctcctcttgctccccttcttccccgtcctcttcctcctcctcctcttcttctccctcctcttcctcctcctctttcttcctgacctctttctttctcctcctcctccttctacctccccttctcatccctcctcttcctcttctctagctgcacacttcactactgcacatcttataacttgcacccctttcttctgaggaagagaacatcttgcaaggcagggcgagcagcggcagggctggcttaggagcagtgcaagagtccctgtgctccagttccacactgctggcagggaaggcaaggggggacgggcctggatctgggggtgagggagaaagatggacccctgggtgaccactaaaccaaagatattcggaactttctatttaggatgtggacgtaattcctgttccgaggtagaggctgtgctgaagacaagcacagtggcctggtgcgccttggaaaccaacaactattcacgagccagtatgaccttcacatctttagaaattatgaaaacgtatgtgattggagggtttggaaaaccagttatcttatttaacattttaaaaattacctaacagttatttacaaacaggtctgtgcatcccaggtctgtcttcttttcaaggtctgggccttgtgctcgggttatgtttgtgggaaatgcttaataaatactgataatatgggaagagatgaaaactgattctcctcactttgtttcaaacctttctggcagtgggatgattcgaattcacttttaaaattaaattagcgtgttttgttttg
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:3651 -> Molecular function: GO:0001046 [core promoter sequence-specific DNA binding] evidence: IEA
GeneID:3651 -> Molecular function: GO:0003682 [chromatin binding] evidence: IEA
GeneID:3651 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: TAS
GeneID:3651 -> Molecular function: GO:0008134 [transcription factor binding] evidence: IEA
GeneID:3651 -> Molecular function: GO:0032403 [protein complex binding] evidence: IEA
GeneID:3651 -> Molecular function: GO:0046982 [protein heterodimerization activity] evidence: IEA
GeneID:3651 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: IEA
GeneID:3651 -> Biological process: GO:0001889 [liver development] evidence: IEA
GeneID:3651 -> Biological process: GO:0003309 [type B pancreatic cell differentiation] evidence: IDA
GeneID:3651 -> Biological process: GO:0003309 [type B pancreatic cell differentiation] evidence: ISS
GeneID:3651 -> Biological process: GO:0006006 [glucose metabolic process] evidence: IEA
GeneID:3651 -> Biological process: GO:0006091 [generation of precursor metabolites and energy] evidence: TAS
GeneID:3651 -> Biological process: GO:0006366 [transcription from RNA polymerase II promoter] evidence: IEA
GeneID:3651 -> Biological process: GO:0007224 [smoothened signaling pathway] evidence: IEA
GeneID:3651 -> Biological process: GO:0007263 [nitric oxide mediated signal transduction] evidence: IDA
GeneID:3651 -> Biological process: GO:0007417 [central nervous system development] evidence: IEA
GeneID:3651 -> Biological process: GO:0008284 [positive regulation of cell proliferation] evidence: IEA
GeneID:3651 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: IEA
GeneID:3651 -> Biological process: GO:0009611 [response to wounding] evidence: IEA
GeneID:3651 -> Biological process: GO:0009887 [organ morphogenesis] evidence: TAS
GeneID:3651 -> Biological process: GO:0010157 [response to chlorate] evidence: IEA
GeneID:3651 -> Biological process: GO:0010260 [organ senescence] evidence: IEA
GeneID:3651 -> Biological process: GO:0010942 [positive regulation of cell death] evidence: IEA
GeneID:3651 -> Biological process: GO:0016331 [morphogenesis of embryonic epithelium] evidence: IEA
GeneID:3651 -> Biological process: GO:0030073 [insulin secretion] evidence: IDA
GeneID:3651 -> Biological process: GO:0031017 [exocrine pancreas development] evidence: IEA
GeneID:3651 -> Biological process: GO:0031018 [endocrine pancreas development] evidence: TAS
GeneID:3651 -> Biological process: GO:0031100 [organ regeneration] evidence: IEA
GeneID:3651 -> Biological process: GO:0032024 [positive regulation of insulin secretion] evidence: IEA
GeneID:3651 -> Biological process: GO:0033273 [response to vitamin] evidence: IEA
GeneID:3651 -> Biological process: GO:0034097 [response to cytokine stimulus] evidence: IEA
GeneID:3651 -> Biological process: GO:0035094 [response to nicotine] evidence: IEA
GeneID:3651 -> Biological process: GO:0042493 [response to drug] evidence: IEA
GeneID:3651 -> Biological process: GO:0042593 [glucose homeostasis] evidence: IEA
GeneID:3651 -> Biological process: GO:0043201 [response to leucine] evidence: IEA
GeneID:3651 -> Biological process: GO:0043388 [positive regulation of DNA binding] evidence: IEA
GeneID:3651 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: ISS
GeneID:3651 -> Biological process: GO:0048565 [digestive tract development] evidence: IEA
GeneID:3651 -> Biological process: GO:0048863 [stem cell differentiation] evidence: IEA
GeneID:3651 -> Biological process: GO:0051384 [response to glucocorticoid stimulus] evidence: IEA
GeneID:3651 -> Biological process: GO:0051594 [detection of glucose] evidence: ISS
GeneID:3651 -> Biological process: GO:0060290 [transdifferentiation] evidence: IEA
GeneID:3651 -> Biological process: GO:0070542 [response to fatty acid] evidence: IEA
GeneID:3651 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
GeneID:3651 -> Cellular component: GO:0005829 [cytosol] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.