Home |
Help |
Advanced search
2025-05-12 01:43:53, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_152390 1703 bp mRNA linear PRI 15-JUN-2013
DEFINITION Homo sapiens transmembrane protein 178A (TMEM178A), transcript
variant 1, mRNA.
ACCESSION NM_152390
VERSION NM_152390.2 GI:269914177
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1703)
AUTHORS Comuzzie,A.G., Cole,S.A., Laston,S.L., Voruganti,V.S., Haack,K.,
Gibbs,R.A. and Butte,N.F.
TITLE Novel genetic loci identified for the pathophysiology of childhood
obesity in the Hispanic population
JOURNAL PLoS ONE 7 (12), E51954 (2012)
PUBMED 23251661
REFERENCE 2 (bases 1 to 1703)
AUTHORS Clark,H.F., Gurney,A.L., Abaya,E., Baker,K., Baldwin,D., Brush,J.,
Chen,J., Chow,B., Chui,C., Crowley,C., Currell,B., Deuel,B.,
Dowd,P., Eaton,D., Foster,J., Grimaldi,C., Gu,Q., Hass,P.E.,
Heldens,S., Huang,A., Kim,H.S., Klimowski,L., Jin,Y., Johnson,S.,
Lee,J., Lewis,L., Liao,D., Mark,M., Robbie,E., Sanchez,C.,
Schoenfeld,J., Seshagiri,S., Simmons,L., Singh,J., Smith,V.,
Stinson,J., Vagts,A., Vandlen,R., Watanabe,C., Wieand,D., Woods,K.,
Xie,M.H., Yansura,D., Yi,S., Yu,G., Yuan,J., Zhang,M., Zhang,Z.,
Goddard,A., Wood,W.I., Godowski,P. and Gray,A.
TITLE The secreted protein discovery initiative (SPDI), a large-scale
effort to identify novel human secreted and transmembrane proteins:
a bioinformatics assessment
JOURNAL Genome Res. 13 (10), 2265-2270 (2003)
PUBMED 12975309
REMARK Erratum:[Genome Res. 2003 Dec;13(12):2759]
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
DN993805.1, BC029530.1 and AC007246.3.
On Nov 25, 2009 this sequence version replaced gi:22748834.
Transcript Variant: This variant (1) represents the longest
transcript and encodes the longest isoform (1).
##Evidence-Data-START##
Transcript exon combination :: BC029530.1, AK075440.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025082, ERS025084 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-58 DN993805.1 7-64
59-398 BC029530.1 4-343
399-399 AC007246.3 93957-93957 c
400-1703 BC029530.1 345-1648
FEATURES Location/Qualifiers
source 1..1703
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="2"
/map="2p22.1"
gene 1..1703
/gene="TMEM178A"
/gene_synonym="TMEM178"
/note="transmembrane protein 178A"
/db_xref="GeneID:130733"
/db_xref="HGNC:28517"
exon 1..480
/gene="TMEM178A"
/gene_synonym="TMEM178"
/inference="alignment:Splign:1.39.8"
variation 72
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="g"
/db_xref="dbSNP:188192195"
CDS 81..974
/gene="TMEM178A"
/gene_synonym="TMEM178"
/note="isoform 1 precursor is encoded by transcript
variant 1; transmembrane protein 178"
/codon_start=1
/product="transmembrane protein 178A isoform 1 precursor"
/protein_id="NP_689603.2"
/db_xref="GI:269914178"
/db_xref="CCDS:CCDS1804.1"
/db_xref="GeneID:130733"
/db_xref="HGNC:28517"
/translation="
MEPRALVTALSLGLSLCSLGLLVTAIFTDHWYETDPRRHKESCERSRAGADPPDQKNRLMPLSHLPLRDSPPLGRRLLPGGPGRADPESWRSLLGLGGLDAECGRPLFATYSGLWRKCYFLGIDRDIDTLILKGIAQRCTAIKYHFSQPIRLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFFWEESLTQHVAGLLFLMTGIFCTISLCTYAASISYDLNRLPKLIYSLPADVEHGYSWSIFCAWCSLGFIVAAGGLCIAYPFISRTKIAQLKSGRDSTV
"
sig_peptide 81..155
/gene="TMEM178A"
/gene_synonym="TMEM178"
/inference="non-experimental evidence, no additional
details recorded"
/note="Potential; propagated from UniProtKB/Swiss-Prot
(Q8NBL3.1)"
mat_peptide 156..971
/gene="TMEM178A"
/gene_synonym="TMEM178"
/product="Transmembrane protein 178A"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q8NBL3.1)"
misc_feature <585..902
/gene="TMEM178A"
/gene_synonym="TMEM178"
/note="PMP-22/EMP/MP20/Claudin tight junction; Region:
Claudin_2; pfam13903"
/db_xref="CDD:206074"
misc_feature 618..680
/gene="TMEM178A"
/gene_synonym="TMEM178"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q8NBL3.1);
transmembrane region"
misc_feature 705..767
/gene="TMEM178A"
/gene_synonym="TMEM178"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q8NBL3.1);
transmembrane region"
misc_feature 852..914
/gene="TMEM178A"
/gene_synonym="TMEM178"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q8NBL3.1);
transmembrane region"
variation 98
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="c"
/db_xref="dbSNP:373389562"
variation 140
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:201221199"
variation 151
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="t"
/db_xref="dbSNP:369145931"
variation 271
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="c"
/db_xref="dbSNP:200656944"
variation 399
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="g"
/db_xref="dbSNP:17852679"
variation 404
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="c"
/db_xref="dbSNP:372463281"
variation 461
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="c"
/db_xref="dbSNP:377194329"
variation 470
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="t"
/db_xref="dbSNP:201650119"
exon 481..594
/gene="TMEM178A"
/gene_synonym="TMEM178"
/inference="alignment:Splign:1.39.8"
variation 488
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:148502563"
variation 490
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:371811326"
variation 500
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:199576215"
variation 515
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="t"
/db_xref="dbSNP:375151652"
variation 538
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:149903489"
variation 590
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="g"
/replace="t"
/db_xref="dbSNP:144202857"
exon 595..732
/gene="TMEM178A"
/gene_synonym="TMEM178"
/inference="alignment:Splign:1.39.8"
variation 632
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="t"
/db_xref="dbSNP:141844962"
variation 638
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="t"
/db_xref="dbSNP:200218947"
variation 650
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="t"
/db_xref="dbSNP:141065930"
variation 658
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="t"
/db_xref="dbSNP:138807729"
variation 704
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="t"
/db_xref="dbSNP:377174385"
exon 733..1686
/gene="TMEM178A"
/gene_synonym="TMEM178"
/inference="alignment:Splign:1.39.8"
variation 735
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="c"
/db_xref="dbSNP:201281373"
variation 749
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="t"
/db_xref="dbSNP:200061855"
variation 755
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="t"
/db_xref="dbSNP:370900847"
variation 766
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="t"
/db_xref="dbSNP:199591656"
variation 768
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:141928270"
variation 794
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:372186330"
variation 816
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="t"
/db_xref="dbSNP:376560766"
variation 860
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="t"
/db_xref="dbSNP:199548184"
variation 868
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:147809327"
variation 883
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="t"
/db_xref="dbSNP:141827016"
variation 888
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:185395702"
variation 917
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:190057123"
variation 928
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:146286536"
variation 947
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:142620766"
variation 1002
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="t"
/db_xref="dbSNP:369677272"
variation 1006
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="t"
/db_xref="dbSNP:142536971"
variation 1018
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:374437026"
variation 1026
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:201625949"
variation 1034
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="g"
/db_xref="dbSNP:182711713"
STS 1187..1420
/gene="TMEM178A"
/gene_synonym="TMEM178"
/standard_name="G65633"
/db_xref="UniSTS:225408"
variation 1263
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:146772305"
variation 1266
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:147946378"
variation 1346
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:186728692"
variation 1376
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="t"
/db_xref="dbSNP:191570624"
variation 1453
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="t"
/db_xref="dbSNP:183783693"
variation 1463
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="c"
/replace="t"
/db_xref="dbSNP:369724230"
variation 1505..1506
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace=""
/replace="t"
/db_xref="dbSNP:34580359"
variation 1505
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace=""
/replace="t"
/db_xref="dbSNP:200054347"
variation 1517
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="t"
/db_xref="dbSNP:75590688"
variation 1519
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:76892392"
STS 1520..1669
/gene="TMEM178A"
/gene_synonym="TMEM178"
/standard_name="SGC31151"
/db_xref="UniSTS:21366"
variation 1571
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:141875764"
variation 1617
/gene="TMEM178A"
/gene_synonym="TMEM178"
/replace="a"
/replace="g"
/db_xref="dbSNP:188720081"
ORIGIN
gggcggagagctggggccaagtgcattgtgtctggcggcggcgcgcgagcccaccggcggctgcggcggggcgggaagccatggagccgcgggcgctcgtcacggcgctcagcctcggcctcagcctgtgctccctggggctgctcgtcacggccatcttcaccgaccactggtacgagaccgacccccggcgccacaaggagagctgcgagcgcagccgcgcgggcgccgaccccccggaccagaagaaccgcctgatgccgctgtcgcacctgccgctgcgggactcgcccccgctggggcgccggctgctcccgggcggcccggggcgcgccgaccccgagtcctggcgctcgctcctggggctcggcgggctggacgccgagtgcggccggcccctcttcgccacctactcgggcctctggaggaagtgctacttcctgggcatcgaccgggacatcgacaccctcatcctgaaaggtattgcgcagcgatgcacggccatcaagtaccacttttctcagcccatccgcttgcgaaacattccttttaatttaaccaagaccatacagcaagatgagtggcacctgcttcatttaagaagaatcactgctggcttcctcggcatggccgtagccgtccttctctgcggctgcattgtggccacagtcagtttcttctgggaggagagcttgacccagcacgtggctggactcctgttcctcatgacagggatattttgcaccatttccctctgtacttatgccgccagtatctcgtatgatttgaaccggctcccaaagctaatttatagcctgcctgctgatgtggaacatggttacagctggtccatcttttgcgcctggtgcagtttaggctttattgtggcagctggaggtctctgcatcgcttatccgtttattagccggaccaagattgcacagctaaagtctggcagagactccacggtatgactgtcctcactgggcctgtccacagtgcgagcgactcctgaggggaacagcgcggagttcaggagtccaagcacaaagcggtcttttacattccaacctgttgcctgccagccctttctggattactgatagaaaatcatgcaaaacctcccaacctttctaaggacaagactactgtggattcaagtgctttaatgactatttatgcgttgactgtgagaatagggagcagtgccatgggacatttctaggtgtagagaaagaagaaactgcaatggaaaaatttgtatgatttccatttatttcagaaagtttgtatgtaacaattacccgagagtcatttctacttgcaaaaggattcgtaacaaagcgagtataattttcttgtcattgtatcatgcttgttaaattttaatgcagcatcttcagaacttgtcctgatggtgtcttattgtgtcagcaccaaatatttgtgcattatttgtggacgttccttgtcacaggaagattcttcttctgttgccttattgtttttttttttttaagtctcttctctgtctttgtactggaatcgaaatcataagataaacagatcaaacgtgcttaagagctaactcgtgacactatgcagtattgtttgaagacctgttgttcaacctctgtctctttatgttaactggatttctgcattaaatgactgcccccttgttaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:130733 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.