2025-06-16 15:34:09, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001193304 4570 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens transmembrane protein 127 (TMEM127), transcript variant 2, mRNA. ACCESSION NM_001193304 VERSION NM_001193304.2 GI:305682551 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 4570) AUTHORS Takeichi,N., Midorikawa,S., Watanabe,A., Naing,B.T., Tamura,H., Wakakuri-Kano,T., Ishizaki,A., Sugihara,H., Nissato,S., Saito,Y., Aita,Y., Ishii,K.A., Igarashi,T., Kawakami,Y., Hara,H., Ikeda,T., Shimizu,K., Suzuki,S., Shimano,H., Kawamoto,M., Shimada,T., Watanabe,T., Oikawa,S. and Takekoshi,K. TITLE Identical germline mutations in the TMEM127 gene in two unrelated Japanese patients with bilateral pheochromocytoma JOURNAL Clin. Endocrinol. (Oxf) 77 (5), 707-714 (2012) PUBMED 22541004 REMARK GeneRIF: report shows that TMEM127 mutation plays a pathological role in pheochromocytoma in an Asian population. REFERENCE 2 (bases 1 to 4570) AUTHORS Neumann,H.P., Sullivan,M., Winter,A., Malinoc,A., Hoffmann,M.M., Boedeker,C.C., Bertz,H., Walz,M.K., Moeller,L.C., Schmid,K.W. and Eng,C. TITLE Germline mutations of the TMEM127 gene in patients with paraganglioma of head and neck and extraadrenal abdominal sites JOURNAL J. Clin. Endocrinol. Metab. 96 (8), E1279-E1282 (2011) PUBMED 21613359 REMARK GeneRIF: TMEM127 germline mutations confer risks of extraadrenal paraganglial tumors in addition to the documented adrenal pheochromocytoma. REFERENCE 3 (bases 1 to 4570) AUTHORS Jiang,S. and Dahia,P.L. TITLE Minireview: the busy road to pheochromocytomas and paragangliomas has a new member, TMEM127 JOURNAL Endocrinology 152 (6), 2133-2140 (2011) PUBMED 21447639 REMARK GeneRIF: TMEM127 is a novel pheochromocytoma susceptibility gene.[review] Review article REFERENCE 4 (bases 1 to 4570) AUTHORS Burnichon,N., Lepoutre-Lussey,C., Laffaire,J., Gadessaud,N., Molinie,V., Hernigou,A., Plouin,P.F., Jeunemaitre,X., Favier,J. and Gimenez-Roqueplo,A.P. TITLE A novel TMEM127 mutation in a patient with familial bilateral pheochromocytoma JOURNAL Eur. J. Endocrinol. 164 (1), 141-145 (2011) PUBMED 20923864 REMARK GeneRIF: Pathological and genomic data demonstrated that a TMEM127 gene mutation not previously described was causative of a new case of familial bilateral pheochromocytoma. REFERENCE 5 (bases 1 to 4570) AUTHORS Yao,L., Schiavi,F., Cascon,A., Qin,Y., Inglada-Perez,L., King,E.E., Toledo,R.A., Ercolino,T., Rapizzi,E., Ricketts,C.J., Mori,L., Giacche,M., Mendola,A., Taschin,E., Boaretto,F., Loli,P., Iacobone,M., Rossi,G.P., Biondi,B., Lima-Junior,J.V., Kater,C.E., Bex,M., Vikkula,M., Grossman,A.B., Gruber,S.B., Barontini,M., Persu,A., Castellano,M., Toledo,S.P., Maher,E.R., Mannelli,M., Opocher,G., Robledo,M. and Dahia,P.L. TITLE Spectrum and prevalence of FP/TMEM127 gene mutations in pheochromocytomas and paragangliomas JOURNAL JAMA 304 (23), 2611-2619 (2010) PUBMED 21156949 REMARK GeneRIF: Germline mutations of FP/TMEM127 were associated with pheochromocytoma but not paraganglioma and occurred in an age group frequently excluded from genetic screening algorithms; mutations disrupt intracellular distribution of the FP/TMEM127 protein. REFERENCE 6 (bases 1 to 4570) AUTHORS Qin,Y., Yao,L., King,E.E., Buddavarapu,K., Lenci,R.E., Chocron,E.S., Lechleiter,J.D., Sass,M., Aronin,N., Schiavi,F., Boaretto,F., Opocher,G., Toledo,R.A., Toledo,S.P., Stiles,C., Aguiar,R.C. and Dahia,P.L. TITLE Germline mutations in TMEM127 confer susceptibility to pheochromocytoma JOURNAL Nat. Genet. 42 (3), 229-233 (2010) PUBMED 20154675 REMARK GeneRIF: Germline mutations in TMEM127 confer susceptibility to pheochromocytoma and identify TMEM127 as a tumor suppressor gene. GeneRIF: Observational study of gene-disease association. (HuGE Navigator) REFERENCE 7 (bases 1 to 4570) AUTHORS Girard,A., Sachidanandam,R., Hannon,G.J. and Carmell,M.A. TITLE A germline-specific class of small RNAs binds mammalian Piwi proteins JOURNAL Nature 442 (7099), 199-202 (2006) PUBMED 16751776 REFERENCE 8 (bases 1 to 4570) AUTHORS Hillier,L.W., Graves,T.A., Fulton,R.S., Fulton,L.A., Pepin,K.H., Minx,P., Wagner-McPherson,C., Layman,D., Wylie,K., Sekhon,M., Becker,M.C., Fewell,G.A., Delehaunty,K.D., Miner,T.L., Nash,W.E., Kremitzki,C., Oddy,L., Du,H., Sun,H., Bradshaw-Cordum,H., Ali,J., Carter,J., Cordes,M., Harris,A., Isak,A., van Brunt,A., Nguyen,C., Du,F., Courtney,L., Kalicki,J., Ozersky,P., Abbott,S., Armstrong,J., Belter,E.A., Caruso,L., Cedroni,M., Cotton,M., Davidson,T., Desai,A., Elliott,G., Erb,T., Fronick,C., Gaige,T., Haakenson,W., Haglund,K., Holmes,A., Harkins,R., Kim,K., Kruchowski,S.S., Strong,C.M., Grewal,N., Goyea,E., Hou,S., Levy,A., Martinka,S., Mead,K., McLellan,M.D., Meyer,R., Randall-Maher,J., Tomlinson,C., Dauphin-Kohlberg,S., Kozlowicz-Reilly,A., Shah,N., Swearengen-Shahid,S., Snider,J., Strong,J.T., Thompson,J., Yoakum,M., Leonard,S., Pearman,C., Trani,L., Radionenko,M., Waligorski,J.E., Wang,C., Rock,S.M., Tin-Wollam,A.M., Maupin,R., Latreille,P., Wendl,M.C., Yang,S.P., Pohl,C., Wallis,J.W., Spieth,J., Bieri,T.A., Berkowicz,N., Nelson,J.O., Osborne,J., Ding,L., Meyer,R., Sabo,A., Shotland,Y., Sinha,P., Wohldmann,P.E., Cook,L.L., Hickenbotham,M.T., Eldred,J., Williams,D., Jones,T.A., She,X., Ciccarelli,F.D., Izaurralde,E., Taylor,J., Schmutz,J., Myers,R.M., Cox,D.R., Huang,X., McPherson,J.D., Mardis,E.R., Clifton,S.W., Warren,W.C., Chinwalla,A.T., Eddy,S.R., Marra,M.A., Ovcharenko,I., Furey,T.S., Miller,W., Eichler,E.E., Bork,P., Suyama,M., Torrents,D., Waterston,R.H. and Wilson,R.K. TITLE Generation and annotation of the DNA sequences of human chromosomes 2 and 4 JOURNAL Nature 434 (7034), 724-731 (2005) PUBMED 15815621 REFERENCE 9 (bases 1 to 4570) AUTHORS Loftus,B.J., Kim,U.J., Sneddon,V.P., Kalush,F., Brandon,R., Fuhrmann,J., Mason,T., Crosby,M.L., Barnstead,M., Cronin,L., Deslattes Mays,A., Cao,Y., Xu,R.X., Kang,H.L., Mitchell,S., Eichler,E.E., Harris,P.C., Venter,J.C. and Adams,M.D. TITLE Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q JOURNAL Genomics 60 (3), 295-308 (1999) PUBMED 10493829 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DA212468.1, BC028575.1 and AC012307.8. On Sep 2, 2010 this sequence version replaced gi:300934845. Summary: This gene encodes a transmembrane protein with 3 predicted transmembrane domains. The protein is associated with a subpopulation of vesicular organelles corresponding to early endosomal structures, with the Golgi, and with lysosomes, and may participate in protein trafficking between these structures. Mutations in this gene and several other genes cause pheochromocytomas. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Aug 2010]. Transcript Variant: This variant (2) has an alternate splice site, resulting in a shorter 5' UTR, as compared to variant 1. Both variants 1 and 2 encode the same protein. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: BC028575.1, AL560993.3 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025082, ERS025083 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-24 DA212468.1 1-24 25-1960 BC028575.1 6-1941 1961-4570 AC012307.8 128546-131155 c FEATURES Location/Qualifiers source 1..4570 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="2" /map="2q11.2" gene 1..4570 /gene="TMEM127" /note="transmembrane protein 127" /db_xref="GeneID:55654" /db_xref="HGNC:26038" /db_xref="MIM:613403" exon 1..145 /gene="TMEM127" /inference="alignment:Splign:1.39.8" misc_feature 140..142 /gene="TMEM127" /note="upstream in-frame stop codon" exon 146..497 /gene="TMEM127" /inference="alignment:Splign:1.39.8" CDS 254..970 /gene="TMEM127" /codon_start=1 /product="transmembrane protein 127" /protein_id="NP_001180233.1" /db_xref="GI:300934846" /db_xref="CCDS:CCDS2018.1" /db_xref="GeneID:55654" /db_xref="HGNC:26038" /db_xref="MIM:613403" /translation="
MYAPGGAGLPGGRRRRSPGGSALPKQPERSLASALPGALSITALCTALAEPAWLHIHGGTCSRQELGVSDVLGYVHPDLLKDFCMNPQTVLLLRVIAAFCFLGILCSLSAFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQQHKKYHGSQVYVTFAVSFYLVAGAGGASILATAANLLRHYPTEEEEQALELLSEMEENEPYPAEYEVINQFQPPPAYTP
" misc_feature 302..304 /gene="TMEM127" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (O75204.1); phosphorylation site" misc_feature 365..841 /gene="TMEM127" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl17758" /db_xref="CDD:248312" misc_feature 539..601 /gene="TMEM127" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (O75204.1); transmembrane region" misc_feature 641..703 /gene="TMEM127" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (O75204.1); transmembrane region" misc_feature 758..820 /gene="TMEM127" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (O75204.1); transmembrane region" exon 498..662 /gene="TMEM127" /inference="alignment:Splign:1.39.8" exon 663..4570 /gene="TMEM127" /inference="alignment:Splign:1.39.8" variation 1186 /gene="TMEM127" /replace="c" /replace="t" /db_xref="dbSNP:200462376" STS 2162..2296 /gene="TMEM127" /standard_name="RH68603" /db_xref="UniSTS:57737" variation 2389 /gene="TMEM127" /replace="c" /replace="g" /db_xref="dbSNP:1061578" variation 2551 /gene="TMEM127" /replace="g" /replace="t" /db_xref="dbSNP:11558941" STS 2860..3021 /gene="TMEM127" /standard_name="D2S1663E" /db_xref="UniSTS:52675" STS 3344..3434 /gene="TMEM127" /standard_name="D8S2279" /db_xref="UniSTS:473907" variation 3482 /gene="TMEM127" /replace="a" /replace="g" /db_xref="dbSNP:1138984" STS 3591..3725 /gene="TMEM127" /standard_name="D2S2931" /db_xref="UniSTS:33276" STS 4065..4192 /gene="TMEM127" /standard_name="SHGC-30679" /db_xref="UniSTS:21283" polyA_site 4204 /gene="TMEM127" ORIGIN
agaggaggaggaagccggaagtgcatcggccccgggtctgtccgggcgttgcgggattggggcctgggaacgctcggcccccggcagccgagaagcccgtgactgggctgagcagcaccatcccagccctggggcctgctgactgcgaacccggagcgttgctatcctccaccggactgtcaggctctgcgcgccccgcggaggtcggcggcgaccagcagcgactgcggagcgacggcgggcggccccgggcatgtacgcccccggaggcgcagggctgcccggcgggcgccggcggaggagcccgggaggcagcgctctgcccaagcagccggagcgtagcctggcctcggccctgcctggcgccctgtctatcacggcgctgtgcactgccctcgccgagcccgcctggttgcacatccacggaggcacctgttcgcgccaggagctgggggtctccgacgtgttgggctatgtgcacccggacctgctgaaagatttctgcatgaatccccagacagtgctgctcctgcgggtcatcgccgccttctgtttcctgggcatcctgtgtagtctctccgctttccttctggatgtctttgggccgaagcatcctgctctgaagatcactcgtcgctatgccttcgcccatatcctaacggttctgcagtgtgccaccgtcattggcttttcttattgggcttctgaactcatcttggcccagcagcagcagcataagaagtaccatggatcccaggtctatgtcaccttcgccgttagcttctacctggtggcaggagctggtggagcctcaatcctggccacggcagccaacctcctgcgccactaccccacagaggaagaggagcaggcgctggagctgctctcagagatggaagagaacgagccctacccggcggaatatgaggtcatcaaccagttccagccaccccctgcttacacaccctaatgccagccctgggctctcttcctcggcagcccctccctcaactctgcagctcctctcgcacccagaggagctcctttccccagcaggcctcactggtaggatcctgaccatcttctccaaaccttccccaggagagactctgcctttagggtcatccaagtatccctgctctcagaaccggaggtccactggttttctataatgtactctttccctcctgccacatcctgcccccttcacattcacgagtcattaccagccagggaaggtcatccaagtttcctccagcatgggcgatatctttgggaccgagactttccttggagagctgctgagagcggacagtcccaaaaacaagtgtcaaagggcccaagggaaaggggactgtgccctggaggctcacttcacagggatcagtgtttgctccacagctgtagctctgggctgacgccccccagaccccttccttctcggagtgacccgcccccaggccacctgctccggggagttctgtgcactttactctttggacttctcctcacgtgtgccctggttttatggggagagggaatcgctgttgggaaggcagagcagttgcaaccctctctgcccttgcttcatgtggctggagcccaggcaaggagagcaggagccagcgtgagactgaggccccctggtgcctatcaaggaccagagtgaaggggactacatctcccagcccttcaccttttaaatatgagtggttttaaaaggaaaaaaatgaaaccaggcaacagcaacaatattctgtttttaaaatagggacaagactgttgtcactttttagacatgtatcccattccttttggctctgcaatatttggggctgtagctccttccaagcccatggtagtccctccccgagtctctcccagtagaatgcagcctcccttccctggccccttccctctcagtgacggtgactccctggggccttctcgtggaacccagaggggctgaggactgtggcctggctggcgggccagcgtggtgctcctcaggactgcagcactgagatggaacctggcctcagtttaggaacaggggccacaacagggcaggaacccaccaccctccacataggaatacaaccagtggggccacatcatgtgaggcatcagacccacactgtcagcccagcaggccgggctgtgtccttcagacccagtgctgccctagactctgactcgggactccagcttgccacgtgccctctcccctcttgaatgtactctggtcttgcagtgtgctgctgggactttcttgctcagccatcactctggtcaccttgtttgctctgggtctggctgaattttctgccctgagatctgggcataaagtggatgaaacttgaaagaccttcagtgtagatccagatggccaacctgtccttgttaagttacttgcttcttgggaatcagtgtcccctgctgagctgaaaaggaaatggattccaatctcttccaacctttaaggtgatagatagtttgagcaagactggagaatggacaacactatgaagctgtggctagaaagggactgtcatgtcccatcctttggccagattgactggggatgtccggacagatgcctgcatgggtggtgagggccacatctgcacacgagccagtggctgcttgcagttcactgctgtgatgccagagtgtgttcaaaggtgactctcctgctcttctggactcttctctcaggcaagaaaggctgcaggctgcctgctatgtgatgcctgagcacaaagccaaggaactgaactaagtctttctgttaagtcctgagtttgtcattggcaggtttacttgtggccagctctctctgcccttgggtgtctgagcaggcagaccagaagaccaggcactggacctgcatgccaaagggactggtcatctcctgaggacctgtaaatgaccctgtggactgttccgcacgatccggaacccactttttattcactccccatgtctttggccttcctcttctttctctttccctctgccatcctgacactgatagtttgtcatataaattccccgggttgtgtttttttttctagaaaaaaattaaaagggaaaacaaaaccaaaaaaaccagaaaccacgaataagaatggaaatgacaatggctgcctgtcatttttctgtcacgattttcctgatttggtttgttccctttgtctcagagaagcaggagatgttgatgaggctgtatttttttttctttttcttgtttttgagacaagagtctcgctctgtcacccgggctggagtgtaacgtggcatgatctcagctcactgcaacctctgcctcctgggttcaagcgattatcctgcctcagcctcctgagtagctgggattacaggcatgcgccactatgcccagataatttttttgtatttttagtagagacagggtttcaccatgttggccaggctggtctggaactcctaacctcaggttatccacccaccttggcctcccaaagtgctgggattataggcatgaaccaccgtgcctggccaaagatgtaatttaaaatagttagaagggacttggcatgggccagctccgtgcatggcattttcacccccagagcttcctaatcctgttttcacacaggaagtttctaggtctttctagaacagctagaaatagtagctgactcccgcccaaggcccaaccttcaaaccctgagctcttcaggctgcatcctctggtgagctatagaggagaacgtggctcctaaactctagccatcctgtgggaggaaatagacttctttgggctgtggcttgcagaacaaactacactttttttccctctattgtttaaattttatttaataatttgtgtgtttttctgtctttattttctgtatttcacgtgttccttcactccctagaaactgcactttctttgaaaccataggtaatgaatcttactaggagaggcatggggatagagacagttctgggagtgtgacctgtaagcctcctgtagggcagtgccaggccttgattgcccacgttctctccgttccttcttccttcatacatttgatcacacagcctacacccagccccgagtgtgcatcacggtaaaagagctgagggctctcttcagggagcagcccatttaggtctcttttgttgttgttagggagaatacacatctttcttggaagctgggagtgtgttctcatttcatgtccattcagacaaagcaccattaggcaccatgaaatatacagtgacggacaggaccctgtctgcaaggattttatgtccttagttcaggagatggacttgtccacagaaaggcagagtgaagtgggcggccggctcggaaaagtcctgtgcccagaagggagccagttctgacctgagtgataatgaaaggcttcctggaggacgcagcttgagccacacttgatgtgggagtgaactgggatagggacactcctgctgagagaatggcaagagcaaaagcacactggtggccaggaggtggtaagagccgaggttagaaaggtgaggggtgctcatttaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:55654 -> Molecular function: GO:0003674 [molecular_function] evidence: ND GeneID:55654 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: IMP GeneID:55654 -> Biological process: GO:0032007 [negative regulation of TOR signaling cascade] evidence: IMP GeneID:55654 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA GeneID:55654 -> Cellular component: GO:0005886 [plasma membrane] evidence: IDA GeneID:55654 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.