LOCUS       NM_001185149             663 bp    mRNA    linear   PRI 07-JUL-2013
DEFINITION  Homo sapiens claudin 24 (CLDN24), mRNA.
ACCESSION   NM_001185149 XM_001714660 XM_001716940 XM_001716970
VERSION     NM_001185149.1  GI:297632382
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 663)
  AUTHORS   Lal-Nag,M. and Morin,P.J.
  TITLE     The claudins
  JOURNAL   Genome Biol. 10 (8), 235 (2009)
   PUBMED   19706201
  REMARK    Review article
REFERENCE   2  (bases 1 to 663)
  AUTHORS   Krause,G., Winkler,L., Mueller,S.L., Haseloff,R.F., Piontek,J. and
            Blasig,I.E.
  TITLE     Structure and function of claudins
  JOURNAL   Biochim. Biophys. Acta 1778 (3), 631-645 (2008)
   PUBMED   18036336
  REMARK    Review article
REFERENCE   3  (bases 1 to 663)
  AUTHORS   Katoh,M. and Katoh,M.
  TITLE     CLDN23 gene, frequently down-regulated in intestinal-type gastric
            cancer, is a novel member of CLAUDIN gene family
  JOURNAL   Int. J. Mol. Med. 11 (6), 683-689 (2003)
   PUBMED   12736707
  REMARK    GeneRIF: CLDN21, clustered with CLDN22 at human chromosome 4q35.1,
            is a four-transmembrane protein with WWCC motif, defined by
            W-X(17-22)-W-X(2)-C-X(8-10)-C.
REFERENCE   4  (bases 1 to 663)
  AUTHORS   Gonzalez-Mariscal,L., Betanzos,A., Nava,P. and Jaramillo,B.E.
  TITLE     Tight junction proteins
  JOURNAL   Prog. Biophys. Mol. Biol. 81 (1), 1-44 (2003)
   PUBMED   12475568
  REMARK    Review article
REFERENCE   5  (bases 1 to 663)
  AUTHORS   Tsukita,S. and Furuse,M.
  TITLE     Claudin-based barrier in simple and stratified cellular sheets
  JOURNAL   Curr. Opin. Cell Biol. 14 (5), 531-536 (2002)
   PUBMED   12231346
  REMARK    Review article
REFERENCE   6  (bases 1 to 663)
  AUTHORS   Tsukita,S., Furuse,M. and Itoh,M.
  TITLE     Multifunctional strands in tight junctions
  JOURNAL   Nat. Rev. Mol. Cell Biol. 2 (4), 285-293 (2001)
   PUBMED   11283726
  REMARK    Review article
REFERENCE   7  (bases 1 to 663)
  AUTHORS   Heiskala,M., Peterson,P.A. and Yang,Y.
  TITLE     The roles of claudin superfamily proteins in paracellular transport
  JOURNAL   Traffic 2 (2), 93-98 (2001)
   PUBMED   11247307
  REMARK    Review article
REFERENCE   8  (bases 1 to 663)
  AUTHORS   Kniesel,U. and Wolburg,H.
  TITLE     Tight junctions of the blood-brain barrier
  JOURNAL   Cell. Mol. Neurobiol. 20 (1), 57-76 (2000)
   PUBMED   10690502
  REMARK    Review article
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC093844.3.
            On or before Jun 9, 2010 this sequence version replaced
            gi:169166401, gi:169166930, gi:169167238.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. The protein encoded by this gene is 75%
            identical to the mouse homolog. This gene is upstream of the CLDN22
            gene, which overlaps the WWC2 gene on the opposite strand in the
            genome.[provided by RefSeq, Aug 2010].
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-663               AC093844.3         114072-114734       c
FEATURES             Location/Qualifiers
     source          1..663
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="4"
                     /map="4q35.1"
     gene            1..663
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /note="claudin 24"
                     /db_xref="GeneID:100132463"
                     /db_xref="HGNC:37200"
     CDS             1..663
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /note="claudin 21"
                     /codon_start=1
                     /product="putative claudin-24"
                     /protein_id="NP_001172078.1"
                     /db_xref="GI:297632383"
                     /db_xref="CCDS:CCDS54824.1"
                     /db_xref="GeneID:100132463"
                     /db_xref="HGNC:37200"
                     /translation="

MALIFRTAMQSVGLLLSLLGWILSIITTYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEVGMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGESQRDLKRRLLILGGILSWASGITALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGGCLLNCAACSSHAPLALGHYAVAQMQTQCPYLEDGTADPQV

"
     misc_feature    31..93
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (A6NM45.2);
                     transmembrane region"
     misc_feature    <145..510
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl15797"
                     /db_xref="CDD:210197"
     misc_feature    244..306
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (A6NM45.2);
                     transmembrane region"
     misc_feature    352..414
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (A6NM45.2);
                     transmembrane region"
     misc_feature    484..546
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (A6NM45.2);
                     transmembrane region"
     exon            1..663
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(39)
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184328199"
     variation       complement(48)
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:115750927"
     variation       complement(52)
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:7688467"
     variation       complement(90)
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376740595"
     variation       complement(175)
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202026421"
     variation       complement(289)
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141964006"
     variation       complement(391)
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148134118"
     variation       complement(409)
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201161896"
     variation       complement(512)
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147080744"
     variation       complement(574)
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200355020"
     variation       complement(621)
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:6839940"
     variation       complement(631)
                     /gene="CLDN24"
                     /gene_synonym="CLDN21"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142081383"
ORIGIN      

atggctttaatctttagaacagcaatgcaatctgttggacttttactatctctcctgggatggattttatccattattacaacttatttgccacactggaagaacctcaacctggacttaaatgaaatggaaaactggaccatgggactctggcaaacctgtgtcatccaagaggaagtggggatgcaatgcaaggactttgactccttcctggctttgcctgctgaactcagggtctccaggatcttaatgtttctgtcaaatgggctgggatttctgggcctgctggtctctgggtttggcctggactgtttgagaattggagagagtcagagagatctcaagaggcgactgctcattctgggaggaattctgtcctgggcctcgggaatcacagccctggttcccgtctcttgggttgcccacaagacggttcaggagttctgggatgagaacgtcccagactttgtccccaggtgggagtttggggaggccctgtttctgggctggtttgctggactttctcttctgctaggagggtgtctgctcaactgcgcagcctgctccagccacgctcccctagctttgggccactatgcagtggcgcaaatgcaaactcagtgtccctacctggaagatgggacagcagatcctcaagtgtaa

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:100132463 -> Molecular function: GO:0005198 [structural molecule activity] evidence: IEA
            GeneID:100132463 -> Cellular component: GO:0005886 [plasma membrane] evidence: IEA
            GeneID:100132463 -> Cellular component: GO:0005923 [tight junction] evidence: IEA
            GeneID:100132463 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA