GGRNA Home | Help | Advanced search

2025-05-12 02:00:17, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001080462            1296 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens transmembrane protein 202 (TMEM202), mRNA.
ACCESSION   NM_001080462 XM_294751
VERSION     NM_001080462.1  GI:122937322
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AC009690.17
            and AC079322.5.
            On Jan 18, 2007 this sequence version replaced gi:113425307.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns ERS025085
                              [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-81                AC009690.17        182238-182318
            82-337              AC009690.17        182564-182819
            338-487             AC079322.5         161587-161736       c
            488-619             AC079322.5         161121-161252       c
            620-1296            AC079322.5         159971-160647       c
FEATURES             Location/Qualifiers
     source          1..1296
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="15"
                     /map="15q24.1"
     gene            1..1296
                     /gene="TMEM202"
                     /note="transmembrane protein 202"
                     /db_xref="GeneID:338949"
                     /db_xref="HGNC:33733"
     CDS             1..822
                     /gene="TMEM202"
                     /codon_start=1
                     /product="transmembrane protein 202"
                     /protein_id="NP_001073931.1"
                     /db_xref="GI:122937323"
                     /db_xref="CCDS:CCDS32287.1"
                     /db_xref="GeneID:338949"
                     /db_xref="HGNC:33733"
                     /translation="
MERREHLTLTFHSPEVPKIKGNRKYQRPTVPAKKHPSASMSCQRQQQLMDQAHIYIRTLCGSLCSFSLLMLIAMSPLNWVQFLVIKNGLELYAGLWTLCNHELCWSHTPKPPYYLQYSRAFFLISVFTILTGLGWLFSSWILNRGSMTTNLDLKVSMLSFISATCLLLCLNLFVAQVHWHTRDAMESDLLWTYYLNWCSDIFYMFAGIISLLNYLTSRSPACDENVTVIPTERSRLGVGPVTTVSPAKDEGPRSEMESLSVREKNLPKSGLWW
"
     misc_feature    157..225
                     /gene="TMEM202"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (A6NGA9.1);
                     transmembrane region"
     misc_feature    202..636
                     /gene="TMEM202"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl15797"
                     /db_xref="CDD:210197"
     misc_feature    361..423
                     /gene="TMEM202"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (A6NGA9.1);
                     transmembrane region"
     misc_feature    463..525
                     /gene="TMEM202"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (A6NGA9.1);
                     transmembrane region"
     misc_feature    565..627
                     /gene="TMEM202"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (A6NGA9.1);
                     transmembrane region"
     exon            1..81
                     /gene="TMEM202"
                     /inference="alignment:Splign:1.39.8"
     variation       7
                     /gene="TMEM202"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:143325433"
     variation       8
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148351239"
     variation       13
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141553031"
     variation       50
                     /gene="TMEM202"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:150902792"
     variation       62
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:137917554"
     variation       67
                     /gene="TMEM202"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139212164"
     variation       68
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142744410"
     variation       80
                     /gene="TMEM202"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:78142209"
     variation       81
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375698920"
     exon            82..337
                     /gene="TMEM202"
                     /inference="alignment:Splign:1.39.8"
     variation       88
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200572212"
     variation       117
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140058943"
     variation       155
                     /gene="TMEM202"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199872123"
     variation       160
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149804291"
     variation       169
                     /gene="TMEM202"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368153584"
     variation       170
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200553858"
     variation       173
                     /gene="TMEM202"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147492128"
     variation       174
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148667101"
     variation       204
                     /gene="TMEM202"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:374110538"
     variation       207
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192687764"
     variation       261
                     /gene="TMEM202"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368277906"
     variation       276
                     /gene="TMEM202"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142190891"
     variation       325
                     /gene="TMEM202"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372766881"
     exon            338..487
                     /gene="TMEM202"
                     /inference="alignment:Splign:1.39.8"
     variation       369
                     /gene="TMEM202"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151215947"
     variation       397
                     /gene="TMEM202"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376359478"
     variation       412
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370205610"
     variation       422
                     /gene="TMEM202"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:141474596"
     variation       430
                     /gene="TMEM202"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146921317"
     variation       439
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111257265"
     exon            488..619
                     /gene="TMEM202"
                     /inference="alignment:Splign:1.39.8"
     variation       523
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200986530"
     variation       524
                     /gene="TMEM202"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370648223"
     variation       530
                     /gene="TMEM202"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147567382"
     variation       544
                     /gene="TMEM202"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:142013465"
     variation       546
                     /gene="TMEM202"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:113026067"
     variation       550
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199977858"
     variation       559
                     /gene="TMEM202"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:201146314"
     variation       567
                     /gene="TMEM202"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:150116129"
     variation       610
                     /gene="TMEM202"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:16956904"
     exon            620..1296
                     /gene="TMEM202"
                     /inference="alignment:Splign:1.39.8"
     variation       638
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149403533"
     variation       640
                     /gene="TMEM202"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:371706800"
     variation       656
                     /gene="TMEM202"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143780703"
     variation       657
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35916586"
     variation       675
                     /gene="TMEM202"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374859725"
     variation       676
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143076809"
     STS             689..828
                     /gene="TMEM202"
                     /standard_name="RH92065"
                     /db_xref="UniSTS:92421"
     variation       697
                     /gene="TMEM202"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:183845057"
     variation       719
                     /gene="TMEM202"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146051533"
     variation       720
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140026568"
     variation       757
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141447513"
     variation       771
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370098117"
     variation       783
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369575080"
     variation       842
                     /gene="TMEM202"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372829280"
     variation       844
                     /gene="TMEM202"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375141280"
     variation       955
                     /gene="TMEM202"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112711703"
     variation       1012..1013
                     /gene="TMEM202"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:35574101"
     variation       1032
                     /gene="TMEM202"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375719157"
     variation       1096
                     /gene="TMEM202"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:77676858"
     variation       1166
                     /gene="TMEM202"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:187867221"
     variation       1296
                     /gene="TMEM202"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:80292455"
ORIGIN      
atggagcgaagggaacatttaaccttgactttccacagtcctgaggttcccaaaataaaggggaaccggaaataccaaaggcctaccgtccctgccaagaaacatccaagtgcctcgatgtcatgccaaaggcagcagcagcttatggatcaggcacacatctacatccgaacgctctgtggcagcctctgtagttttagcctcctaatgctgatcgccatgtccccactgaactgggtacagtttctggtgatcaagaatggccttgagctctacgcaggactctggaccttatgcaaccatgagctgtgctggagccacacacccaagccaccctattatctccaatattccagggccttctttctcatctctgtctttaccatacttactggccttggctggctcttcagctcttggatccttaatcgaggaagcatgaccaccaacttggatctgaaggtatccatgctcagcttcatctcagctacctgcttgctcctctgcctcaacctgtttgtggcacaggttcactggcatactagggatgccatggagtcagatctcctatggacctattatcttaactggtgcagtgacatcttttacatgtttgctgggatcatctctcttctcaactacttaacttccagatcgcctgcctgtgatgaaaacgtcactgtgattccaacagagagatcaaggctgggggttggtccggtgactacagtatcacctgctaaagatgaagggccaaggtctgagatggaatctctaagtgtgagagagaaaaatttaccaaagtcaggactgtggtggtgataggaaaacctaactatagcttgtcttaaaagcaggggagaagctgagttgggaatggtcacataaattctgggaaactctcctaatatcatgtccatattacttgaggagacagcattaaagctgatgaaatgtcttttgcgtgcattggatccaaaatatatatgatagtcataaagtaaataactcacttaagaaaaacatttctaaaagaaaacaacaatgtttagagtcatgaatgaaagaaactagtgaaagatgcagtgtgtagaccagagacctctttgggtatcagggatctcatggaccagaatggcccgtggagaagaatgttaattacttctgtttggaattttctttattatgtgtggctttgggtatactcaggatggaaagcacttggacaaatactgttgaatctgaacttaatagcattaccagaaatggaataaatatcaatggatataagaccta
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:338949 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.