GGRNA Home | Help | Advanced search

2025-05-12 01:19:00, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001040200            1883 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens claudin domain containing 1 (CLDND1), transcript
            variant 7, mRNA.
ACCESSION   NM_001040200
VERSION     NM_001040200.1  GI:93588656
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1883)
  AUTHORS   Liu,Y., Sun,W., Zhang,K., Zheng,H., Ma,Y., Lin,D., Zhang,X.,
            Feng,L., Lei,W., Zhang,Z., Guo,S., Han,N., Tong,W., Feng,X., Gao,Y.
            and Cheng,S.
  TITLE     Identification of genes differentially expressed in human primary
            lung squamous cell carcinoma
  JOURNAL   Lung Cancer 56 (3), 307-317 (2007)
   PUBMED   17316888
  REMARK    GeneRIF: A cDNA library consisting of 220 upregulated genes in
            tumour tissue was established and named as LSCC. Differential
            expression was confirmed in five of these genes, including IGFBP5,
            SQLE, RAP2B, CLDN1, and TBL1XR1.
REFERENCE   2  (bases 1 to 1883)
  AUTHORS   Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z.,
            Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S.,
            McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J.,
            Dunham,I., Hill,D.E. and Vidal,M.
  TITLE     hORFeome v3.1: a resource of human open reading frames representing
            over 10,000 human genes
  JOURNAL   Genomics 89 (3), 307-315 (2007)
   PUBMED   17207965
REFERENCE   3  (bases 1 to 1883)
  AUTHORS   Fayein,N.A., Stankoff,B., Auffray,C. and Devignes,M.D.
  TITLE     Characterization of tissue expression and full-length coding
            sequence of a novel human gene mapping at 3q12.1 and transcribed in
            oligodendrocytes
  JOURNAL   Gene 289 (1-2), 119-129 (2002)
   PUBMED   12036590
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DB461184.1, AC021660.16, DB465920.1 and AA811441.1.
            
            Transcript Variant: This variant (7) lacks an alternate exon in the
            5' coding region and uses an upstream start codon, compared to
            variant 1. Variant 7 encodes an isoform with a distinct N-terminus
            (d), compared to isoform a.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AV656305.1, BP377519.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025083 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-11                DB461184.1         1-11
            12-12               AC021660.16        119164-119164
            13-159              DB461184.1         13-159
            160-570             DB465920.1         1-411
            571-1385            AC021660.16        125443-126257
            1386-1883           AA811441.1         1-498               c
FEATURES             Location/Qualifiers
     source          1..1883
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="3"
                     /map="3q12.1"
     gene            1..1883
                     /gene="CLDND1"
                     /gene_synonym="C3orf4; GENX-3745"
                     /note="claudin domain containing 1"
                     /db_xref="GeneID:56650"
                     /db_xref="HGNC:1322"
     exon            1..218
                     /gene="CLDND1"
                     /gene_synonym="C3orf4; GENX-3745"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    191..193
                     /gene="CLDND1"
                     /gene_synonym="C3orf4; GENX-3745"
                     /note="upstream in-frame stop codon"
     CDS             212..688
                     /gene="CLDND1"
                     /gene_synonym="C3orf4; GENX-3745"
                     /note="isoform d is encoded by transcript variant 7;
                     claudin domain containing 1 protein; claudin
                     domain-containing protein 1; membrane protein GENX-3745"
                     /codon_start=1
                     /product="claudin domain-containing protein 1 isoform d"
                     /protein_id="NP_001035290.1"
                     /db_xref="GI:93588657"
                     /db_xref="CCDS:CCDS43116.1"
                     /db_xref="GeneID:56650"
                     /db_xref="HGNC:1322"
                     /translation="
MGESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPDNVSGEFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVA
"
     misc_feature    <287..628
                     /gene="CLDND1"
                     /gene_synonym="C3orf4; GENX-3745"
                     /note="PMP-22/EMP/MP20/Claudin tight junction; Region:
                     Claudin_2; pfam13903"
                     /db_xref="CDD:206074"
     exon            219..329
                     /gene="CLDND1"
                     /gene_synonym="C3orf4; GENX-3745"
                     /inference="alignment:Splign:1.39.8"
     exon            330..467
                     /gene="CLDND1"
                     /gene_synonym="C3orf4; GENX-3745"
                     /inference="alignment:Splign:1.39.8"
     variation       421
                     /gene="CLDND1"
                     /gene_synonym="C3orf4; GENX-3745"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:11553641"
     variation       424
                     /gene="CLDND1"
                     /gene_synonym="C3orf4; GENX-3745"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35994971"
     exon            468..1874
                     /gene="CLDND1"
                     /gene_synonym="C3orf4; GENX-3745"
                     /inference="alignment:Splign:1.39.8"
     variation       610
                     /gene="CLDND1"
                     /gene_synonym="C3orf4; GENX-3745"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:11553649"
     STS             670..760
                     /gene="CLDND1"
                     /gene_synonym="C3orf4; GENX-3745"
                     /standard_name="D3S2932E"
                     /db_xref="UniSTS:150916"
     variation       1593
                     /gene="CLDND1"
                     /gene_synonym="C3orf4; GENX-3745"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11553644"
     STS             1637..1839
                     /gene="CLDND1"
                     /gene_synonym="C3orf4; GENX-3745"
                     /standard_name="D3S3109"
                     /db_xref="UniSTS:80916"
     polyA_signal    1841..1846
                     /gene="CLDND1"
                     /gene_synonym="C3orf4; GENX-3745"
     polyA_signal    1847..1852
                     /gene="CLDND1"
                     /gene_synonym="C3orf4; GENX-3745"
     polyA_site      1864
                     /gene="CLDND1"
                     /gene_synonym="C3orf4; GENX-3745"
     polyA_site      1874
                     /gene="CLDND1"
                     /gene_synonym="C3orf4; GENX-3745"
ORIGIN      
tatcgccgcctcagacagctttcagtctgtccctcctacaactcccacaaggcccctcggccccgggccgcggcccggcccggagtgggggcgggcggaggcgcgggagttatggagggggcgggctctgcagggaagtgcgtcagaggaggcgcggggagagtagggtgctgtggtctgagctagagggtgaagctggcggagcaggaggatgggcgagtcatttgatgtggtcacaaaatgtgtgagtttcacactaactgagcagttcatggagaaatttgttgatcccggaaaccacaatagcgggattgatctccttaggacctatctttggcgttgccagttccttttaccttttgtgagtttaggtttgatgtgctttggggctttgatcggactttgtgcttgcatttgccgaagcttatatcccaccattgccacgggcattctccatctccttgcaggtctgtgtacactgggctcagtaagttgttatgttgctggaattgaactactccaccagaaactagagctccctgacaatgtatccggtgaatttggatggtccttctgcctggcttgtgtctctgctcccttacagttcatggcttctgctctcttcatctgggctgctcacaccaaccggaaagagtacaccttaatgaaggcatatcgtgtggcatgagcaagaaactgcctgctttacaattgccatttttatttttttaaaataatactgatattttccccacctctcaattgtttttaatttttatttgtggatataccattttattatgaaaatctattttatttatacacattcaccactaaatacacacttaataccactaaaatttatgtggtttactttaagcgatgccatctttcaaataaactaatctaggtctagacagaaagaaatggatagagacttgacacaaatttatgaaagaaaattgggagtaggaatgtgaccgaaaacaagttgtgctaatgtctgttagacttttcagtaaaactaaagtaactgtatctgttcaactaaaaactctatattagtttctttgggaaacctctcatcgtcaaaactttatgttcactttgctgttgtagatagccagtcaaccagcagtattagtgctgttttcaaagatttaagctctataaaattgggaaattatctaagatcattttccctaagcattgacacatagcttcatctgaggtgagatatggcagctgtttgtatctgcactgtgtctgtctacaaaaagtgaaaaatacagtgtttacttgaaattttaactttgtaactgcaagaattccagttcagccgggcgaggattagtattatttttaactctccgtaagattttcagtaccaccaaattgttttggattttttttctttcctcttcacataccagggttattaaaagtgtgctttctttttacattatattacagttacaaggtaaaattcctcaactgctatttatttattccagcccagtactataaagaacgtttcaccataatgaccctccagagctgggaaacctaccacaagatctaaagttctggctgtccattaacctccaactatggtctttatttcttgtggtaatatgatgtgcctttccttgcctaaatcccttcctggtgtgtatcaacattatttaatgtcttctaattcagtcatttttttataagtatgtctataaacattgaactttaaaaaacttatttatttattccactactgtagcaattgacagattaaaaaaatgtaacttcataatttcttaccataacctcaatgtcttttttaaaaaataaaattaaaaatgaaaagagactcaattgtaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:56650 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.