2025-05-12 01:41:48, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001013743 1098 bp mRNA linear PRI 15-JUN-2013 DEFINITION Homo sapiens transmembrane protein 225 (TMEM225), mRNA. ACCESSION NM_001013743 XM_290501 VERSION NM_001013743.1 GI:62000697 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1098) AUTHORS Wu,J.H., Lemaitre,R.N., Manichaikul,A., Guan,W., Tanaka,T., Foy,M., Kabagambe,E.K., Djousse,L., Siscovick,D., Fretts,A.M., Johnson,C., King,I.B., Psaty,B.M., McKnight,B., Rich,S.S., Chen,Y.D., Nettleton,J.A., Tang,W., Bandinelli,S., Jacobs,D.R. Jr., Browning,B.L., Laurie,C.C., Gu,X., Tsai,M.Y., Steffen,L.M., Ferrucci,L., Fornage,M. and Mozaffarian,D. TITLE Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium JOURNAL Circ Cardiovasc Genet 6 (2), 171-183 (2013) PUBMED 23362303 REFERENCE 2 (bases 1 to 1098) AUTHORS Hendrickx,A., Beullens,M., Ceulemans,H., Den Abt,T., Van Eynde,A., Nicolaescu,E., Lesage,B. and Bollen,M. TITLE Docking motif-guided mapping of the interactome of protein phosphatase-1 JOURNAL Chem. Biol. 16 (4), 365-371 (2009) PUBMED 19389623 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AY634366.1. On Mar 31, 2005 this sequence version replaced gi:42659618. ##Evidence-Data-START## Transcript exon combination :: AY634366.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025085 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1098 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="11" /map="11q24.1" gene 1..1098 /gene="TMEM225" /gene_synonym="PMP22CD" /note="transmembrane protein 225" /db_xref="GeneID:338661" /db_xref="HGNC:32390" /db_xref="HPRD:18492" exon 1..389 /gene="TMEM225" /gene_synonym="PMP22CD" /inference="alignment:Splign:1.39.8" misc_feature 191..193 /gene="TMEM225" /gene_synonym="PMP22CD" /note="upstream in-frame stop codon" CDS 209..886 /gene="TMEM225" /gene_synonym="PMP22CD" /note="PMP22 claudin domain containing; PMP22 claudin domain-containing protein" /codon_start=1 /product="transmembrane protein 225" /protein_id="NP_001013765.1" /db_xref="GI:62000698" /db_xref="CCDS:CCDS31697.1" /db_xref="GeneID:338661" /db_xref="HGNC:32390" /db_xref="HPRD:18492" /translation="
MVHVSNRSIQGMNILFSSWAVVLMVMGITLDKWVELISEDERAKMNHSPWMMCCPALWPEDDLKVVRIMMTSSLGLSFLLNLILGMKFTYLIPQNKYIQLFTTILSFFSGISLLWALILYHNKLKQGQSMHFSNYRITWIMYTAYLNVFFLSVCGVLSLLECKLSTSSCTCLNIHKSDNECKESENSIEDISLPECTAMPRSIVRAHTVNSLNKKVQTRHVTWAL
" misc_feature 233..295 /gene="TMEM225" /gene_synonym="PMP22CD" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q6GV28.1); transmembrane region" misc_feature 263..688 /gene="TMEM225" /gene_synonym="PMP22CD" /note="PMP-22/EMP/MP20/Claudin tight junction; Region: Claudin_2; pfam13903" /db_xref="CDD:206074" misc_feature 425..487 /gene="TMEM225" /gene_synonym="PMP22CD" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q6GV28.1); transmembrane region" misc_feature 506..568 /gene="TMEM225" /gene_synonym="PMP22CD" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q6GV28.1); transmembrane region" misc_feature 617..679 /gene="TMEM225" /gene_synonym="PMP22CD" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q6GV28.1); transmembrane region" STS 247..388 /gene="TMEM225" /gene_synonym="PMP22CD" /standard_name="RH93164" /db_xref="UniSTS:92500" exon 390..536 /gene="TMEM225" /gene_synonym="PMP22CD" /inference="alignment:Splign:1.39.8" exon 537..671 /gene="TMEM225" /gene_synonym="PMP22CD" /inference="alignment:Splign:1.39.8" exon 672..1098 /gene="TMEM225" /gene_synonym="PMP22CD" /inference="alignment:Splign:1.39.8" STS 788..958 /gene="TMEM225" /gene_synonym="PMP22CD" /standard_name="RH102553" /db_xref="UniSTS:96887" variation 794 /gene="TMEM225" /gene_synonym="PMP22CD" /replace="c" /replace="t" /db_xref="dbSNP:1939927" variation 928 /gene="TMEM225" /gene_synonym="PMP22CD" /replace="a" /replace="g" /db_xref="dbSNP:1939928" variation 1045 /gene="TMEM225" /gene_synonym="PMP22CD" /replace="c" /replace="t" /db_xref="dbSNP:1054041" ORIGIN
acagcaggctggccctgatagataacggaagtgaggaagggtgagagttatctatcttctctgttttatagactacttcagcttctgctgttaccaatgcctcagcaaccactgaaagttcagatatcacccttcttgtaactaatcaaatcaaggaagagatctacaaaatagtggtggtggttccagctagaaattttcactcacaatggtgcatgtttcaaatagaagtatccagggtatgaacatacttttctcctcctgggccgtagtcttaatggtgatgggaatcaccttagataaatgggttgaattgatttcagaagatgaaagagccaagatgaaccacagtccttggatgatgtgttgccctgctctttggccagaagatgacctgaaagtggtcaggattatgatgacgtcgagccttggcctttccttcctccttaacttaatcctgggtatgaaattcacctatctgattcctcaaaataaatatatacaactcttcactaccatcctcagtttcttctcaggtatctctctgctctgggcactcatactatatcacaataagctgaagcaaggtcaatccatgcacttctctaattataggatcacctggatcatgtatactgcttacttaaatgttttcttcttgtctgtctgtggagtcctctctctcctagagtgcaagttgtctaccagtagctgtacctgcctgaacatccataaatctgacaacgaatgtaaggaatctgagaattctatcgaagatatttcattaccagaatgcactgcaatgcctcgtagcattgtccgtgcacacactgtgaattccctaaacaaaaaagtccaaacacgtcacgtaacctgggctctgtgatttggcaatctatttcttgcagtatatgctcatctttatggaaaaagctttgtgggtgtgtgctgtgtctccaaccatgttgtctctatttggaattatggttggggtttgtaaaaagatctggaagatggttttttaaaaaatcctggcctgctgaacgaatagtttcttctgcaacatttgttgttaatataataaatattatcatataa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:338661 -> Biological process: GO:0010923 [negative regulation of phosphatase activity] evidence: IDA GeneID:338661 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.