Home |
Help |
Advanced search
2026-05-14 01:52:39, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_003277 1720 bp mRNA linear PRI 07-JUL-2013 DEFINITION Homo sapiens claudin 5 (CLDN5), transcript variant 2, mRNA. ACCESSION NM_003277 VERSION NM_003277.3 GI:195947371 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1720) AUTHORS Herr,D., Fraser,H.M., Konrad,R., Holzheu,I., Kreienberg,R. and Wulff,C. TITLE Human chorionic gonadotropin controls luteal vascular permeability via vascular endothelial growth factor by down-regulation of a cascade of adhesion proteins JOURNAL Fertil. Steril. 99 (6), 1749-1758 (2013) PUBMED 23465821 REMARK GeneRIF: Chorionic gonadotropin induces VEGFA-dependent downregulation of claudin 5, which increases the endothelial permeability in the coculture system. REFERENCE 2 (bases 1 to 1720) AUTHORS Kluger,M.S., Clark,P.R., Tellides,G., Gerke,V. and Pober,J.S. TITLE Claudin-5 controls intercellular barriers of human dermal microvascular but not human umbilical vein endothelial cells JOURNAL Arterioscler. Thromb. Vasc. Biol. 33 (3), 489-500 (2013) PUBMED 23288152 REMARK GeneRIF: Claudin-5 expression and junctional organization controls intercellular barriers of human dermal microvascular but not human umbilical vein endothelial cells. REFERENCE 3 (bases 1 to 1720) AUTHORS Hara,H. TITLE Endoglin (CD105) and claudin-5 expression in cutaneous angiosarcoma JOURNAL Am J Dermatopathol 34 (7), 779-782 (2012) PUBMED 23000880 REMARK GeneRIF: Letter: confirm the endothelial cell origin of cutaneous angiosarcoma and demonstrate that both endoglin and claudin-5 show promise as markers for cutaneous angiosarcoma. REFERENCE 4 (bases 1 to 1720) AUTHORS Sanders,Y.Y., Ambalavanan,N., Halloran,B., Zhang,X., Liu,H., Crossman,D.K., Bray,M., Zhang,K., Thannickal,V.J. and Hagood,J.S. TITLE Altered DNA methylation profile in idiopathic pulmonary fibrosis JOURNAL Am. J. Respir. Crit. Care Med. 186 (6), 525-535 (2012) PUBMED 22700861 REMARK GeneRIF: CLDN5 gene DNA meyhylation suggesting the pathogenesis of idiopathic pulmonary fibrosis. REFERENCE 5 (bases 1 to 1720) AUTHORS Armstrong,S.M., Wang,C., Tigdi,J., Si,X., Dumpit,C., Charles,S., Gamage,A., Moraes,T.J. and Lee,W.L. TITLE Influenza infects lung microvascular endothelium leading to microvascular leak: role of apoptosis and claudin-5 JOURNAL PLoS ONE 7 (10), E47323 (2012) PUBMED 23115643 REMARK GeneRIF: Over-expression of claudin-5 was sufficient to prevent replication-deficient virus-induced permeability REFERENCE 6 (bases 1 to 1720) AUTHORS Kniesel,U. and Wolburg,H. TITLE Tight junctions of the blood-brain barrier JOURNAL Cell. Mol. Neurobiol. 20 (1), 57-76 (2000) PUBMED 10690502 REMARK Review article REFERENCE 7 (bases 1 to 1720) AUTHORS Itoh,M., Furuse,M., Morita,K., Kubota,K., Saitou,M. and Tsukita,S. TITLE Direct binding of three tight junction-associated MAGUKs, ZO-1, ZO-2, and ZO-3, with the COOH termini of claudins JOURNAL J. Cell Biol. 147 (6), 1351-1363 (1999) PUBMED 10601346 REFERENCE 8 (bases 1 to 1720) AUTHORS Morita,K., Furuse,M., Fujimoto,K. and Tsukita,S. TITLE Claudin multigene family encoding four-transmembrane domain protein components of tight junction strands JOURNAL Proc. Natl. Acad. Sci. U.S.A. 96 (2), 511-516 (1999) PUBMED 9892664 REFERENCE 9 (bases 1 to 1720) AUTHORS Peacock,R.E., Keen,T.J. and Inglehearn,C.F. TITLE Analysis of a human gene homologous to rat ventral prostate.1 protein JOURNAL Genomics 46 (3), 443-449 (1997) PUBMED 9441748 REFERENCE 10 (bases 1 to 1720) AUTHORS Sirotkin,H., Morrow,B., Saint-Jore,B., Puech,A., Das Gupta,R., Patanjali,S.R., Skoultchi,A., Weissman,S.M. and Kucherlapati,R. TITLE Identification, characterization, and precise mapping of a human gene encoding a novel membrane-spanning protein from the 22q11 region deleted in velo-cardio-facial syndrome JOURNAL Genomics 42 (2), 245-251 (1997) PUBMED 9192844 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DB023636.1, AK092561.1 and BU688528.1. On Aug 7, 2008 this sequence version replaced gi:38570041. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2008]. Transcript Variant: This variant (2) lacks a segment in the 5' UTR, as compared to variant 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: CB993999.1, BX382073.2 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-542 DB023636.1 1-542 543-1699 AK092561.1 1155-2311 1700-1720 BU688528.1 1-21 c FEATURES Location/Qualifiers source 1..1720 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="22" /map="22q11.21" gene 1..1720 /gene="CLDN5" /gene_synonym="AWAL; BEC1; CPETRL1; TMVCF" /note="claudin 5" /db_xref="GeneID:7122" /db_xref="HGNC:2047" /db_xref="MIM:602101" exon 1..183 /gene="CLDN5" /gene_synonym="AWAL; BEC1; CPETRL1; TMVCF" /inference="alignment:Splign:1.39.8" misc_feature 171..173 /gene="CLDN5" /gene_synonym="AWAL; BEC1; CPETRL1; TMVCF" /note="upstream in-frame stop codon" exon 184..1702 /gene="CLDN5" /gene_synonym="AWAL; BEC1; CPETRL1; TMVCF" /inference="alignment:Splign:1.39.8" CDS 216..1127 /gene="CLDN5" /gene_synonym="AWAL; BEC1; CPETRL1; TMVCF" /note="transmembrane protein deleted in velocardiofacial syndrome; TMDVCF; transmembrane protein deleted in VCFS" /codon_start=1 /product="claudin-5" /protein_id="NP_003268.2" /db_xref="GI:195947372" /db_xref="CCDS:CCDS13763.2" /db_xref="GeneID:7122" /db_xref="HGNC:2047" /db_xref="MIM:602101" /translation="
MTRARIGCFGPGGRARGTESAPEPSKRVPPGRSWQTQEVRQTRGANGLGPRAGSAGAKAPGPAQGAAQHGLGGSAGLRVRVSPLAMGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV
"
misc_feature <600..980
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMVCF"
/note="PMP-22/EMP/MP20/Claudin family; Region:
PMP22_Claudin; cl15797"
/db_xref="CDD:210197"
variation 381
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMVCF"
/replace="g"
/replace="t"
/db_xref="dbSNP:11551254"
STS 501..617
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMVCF"
/standard_name="D22S1668"
/db_xref="UniSTS:474045"
variation 617
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMVCF"
/replace="c"
/replace="g"
/db_xref="dbSNP:1053613"
variation 773
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMVCF"
/replace="c"
/replace="t"
/db_xref="dbSNP:34379045"
variation 797
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMVCF"
/replace="a"
/replace="c"
/db_xref="dbSNP:11551255"
variation 1514
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMVCF"
/replace="a"
/replace="c"
/db_xref="dbSNP:1053640"
variation 1521
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMVCF"
/replace="a"
/replace="g"
/db_xref="dbSNP:1053641"
STS 1524..1680
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMVCF"
/standard_name="A006E34"
/db_xref="UniSTS:60692"
variation 1531
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMVCF"
/replace="c"
/replace="g"
/db_xref="dbSNP:10314"
STS 1563..1681
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMVCF"
/standard_name="D22S983E"
/db_xref="UniSTS:35519"
variation 1633
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMVCF"
/replace="a"
/replace="c"
/db_xref="dbSNP:1053666"
variation 1647
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMVCF"
/replace="a"
/replace="g"
/db_xref="dbSNP:1053675"
polyA_site 1699
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMVCF"
polyA_site 1702
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMVCF"
ORIGIN
gtctctcctgtctgaaggccagagcaggctgctaggcctggggccaccactgcccctgggtgctacacccagtgtgctgggtcactgggaacttcctgaagtggtgtcacctgaactgggcccccaaggatggggtgcgggcagtaccgcaggaagaggagcagcccctgtgaagattgagagctgccagaggctctgtgattggctgcggcacgatgacccgcgcacggattggctgcttcgggccggggggccgggcccgggggacagaatccgcccccgaaccttcaaagagggtaccccccggcaggagctggcagacccaggaggtgcgacagacccgcggggcaaacggactggggccaagagccgggagcgcgggcgcaaaggcaccagggcccgcccagggcgccgcgcagcacggccttgggggttctgcgggccttcgggtgcgcgtctcgcctctagccatggggtccgcagcgttggagatcctgggcctggtgctgtgcctggtgggctgggggggtctgatcctggcgtgcgggctgcccatgtggcaggtgaccgccttcctggaccacaacatcgtgacggcgcagaccacctggaaggggctgtggatgtcgtgcgtggtgcagagcaccgggcacatgcagtgcaaagtgtacgactcggtgctggctctgagcaccgaggtgcaggcggcgcgggcgctcaccgtgagcgccgtgctgctggcgttcgttgcgctcttcgtgaccctggcgggcgcgcagtgcaccacctgcgtggccccgggcccggccaaggcgcgtgtggccctcacgggaggcgtgctctacctgttttgcgggctgctggcgctcgtgccactctgctggttcgccaacattgtcgtccgcgagttttacgacccgtctgtgcccgtgtcgcagaagtacgagctgggcgcagcgctgtacatcggctgggcggccaccgcgctgctcatggtaggcggctgcctcttgtgctgcggcgcctgggtctgcaccggccgtcccgacctcagcttccccgtgaagtactcagcgccgcggcggcccacggccaccggcgactacgacaagaagaactacgtctgagggcgctgggcacggccgggcccctcctgccagccacgcctgcgaggcgttggataagcctggggagccccgcatggaccgcggcttccgccgggtagcgcggcgcgcaggctcctcggaacgtccggctctgcgccccgacgcggctcctggatccgctcctgcctgcgcccgcagctgaccttctcctgccactagcccggccctgcccttaacagacggaatgaagtttccttttctgtgcgcggcgctgtttccataggcagagcgggtgtcagactgaggatttcgcttcccctccaagacgctgggggtcttggctgctgccttacttcccagaggctcctgctgacttcggaggggcggatgcagagcccagggcccccaccggaagatgtgtacagctggtctttactccatcggcagggcccgagcccagggaccagtgacttggcctggacctcccggtctcactccagcatctccccaggcaaggcttgtgggcaccggagcttgagagagggcgggagtgggaaggctaagaatctgcttagtaaatggtttgaactctctccaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:7122 -> Molecular function: GO:0005198 [structural molecule activity] evidence: IEA
GeneID:7122 -> Molecular function: GO:0042802 [identical protein binding] evidence: ISS
GeneID:7122 -> Biological process: GO:0016338 [calcium-independent cell-cell adhesion] evidence: ISS
GeneID:7122 -> Biological process: GO:0042552 [myelination] evidence: IEA
GeneID:7122 -> Cellular component: GO:0005886 [plasma membrane] evidence: IEA
GeneID:7122 -> Cellular component: GO:0005911 [cell-cell junction] evidence: IDA
GeneID:7122 -> Cellular component: GO:0005923 [tight junction] evidence: ISS
GeneID:7122 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA
GeneID:7122 -> Cellular component: GO:0033270 [paranode region of axon] evidence: IEA
GeneID:7122 -> Cellular component: GO:0043220 [Schmidt-Lanterman incisure] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.