GGRNA Home | Help | Advanced search

2025-05-09 20:12:06, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_152715               4041 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens tubulin folding cofactor E-like (TBCEL), transcript
            variant 1, mRNA.
ACCESSION   NM_152715
VERSION     NM_152715.3  GI:194239698
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4041)
  AUTHORS   Sellin,M.E., Holmfeldt,P., Stenmark,S. and Gullberg,M.
  TITLE     Op18/Stathmin counteracts the activity of overexpressed
            tubulin-disrupting proteins in a human leukemia cell line
  JOURNAL   Exp. Cell Res. 314 (6), 1367-1377 (2008)
   PUBMED   18262179
  REMARK    GeneRIF: Depletion of Op18 by means of RNA interference increased
            the susceptibility of tubulin to TBCE or E-like mediated
            disruption, while overexpressed Op18 exerted a tubulin-protective
            effect.
REFERENCE   2  (bases 1 to 4041)
  AUTHORS   Bartolini,F., Tian,G., Piehl,M., Cassimeris,L., Lewis,S.A. and
            Cowan,N.J.
  TITLE     Identification of a novel tubulin-destabilizing protein related to
            the chaperone cofactor E
  JOURNAL   J. Cell. Sci. 118 (PT 6), 1197-1207 (2005)
   PUBMED   15728251
  REMARK    GeneRIF: Leucine rich repeat containing 35 (E-like) is a novel
            regulator of tubulin stability with overexpression causing
            depolymerization of microtubules and suppression resulting in an
            increase in the number of stable microtubules.
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DB481993.2, AY398644.1, BC020501.1, DN602255.1, AI128257.1 and
            BX091943.1.
            On Jul 12, 2008 this sequence version replaced gi:56693214.
            
            Transcript Variant: This variant (1) represents the longer
            transcript. Variants 1 and 2 encode the same protein.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY398644.1, AK295673.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025083, ERS025084 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-17                DB481993.2         1-17
            18-880              AY398644.1         1-863
            881-2899            BC020501.1         790-2808
            2900-3355           DN602255.1         355-810
            3356-3623           AI128257.1         40-307              c
            3624-4041           BX091943.1         1-418               c
FEATURES             Location/Qualifiers
     source          1..4041
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="11"
                     /map="11q23.3"
     gene            1..4041
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /note="tubulin folding cofactor E-like"
                     /db_xref="GeneID:219899"
                     /db_xref="HGNC:28115"
                     /db_xref="MIM:610451"
     exon            1..188
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /inference="alignment:Splign:1.39.8"
     variation       18
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:370834296"
     variation       71
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11606542"
     variation       73
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374216654"
     exon            189..338
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    194..196
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /note="upstream in-frame stop codon"
     CDS             206..1480
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /note="catastrophin; leucine rich repeat containing 35;
                     tubulin-specific chaperone e-like; E-like; leucine-rich
                     repeat-containing protein 35"
                     /codon_start=1
                     /product="tubulin-specific chaperone cofactor E-like
                     protein"
                     /protein_id="NP_689928.3"
                     /db_xref="GI:194239699"
                     /db_xref="CCDS:CCDS31692.1"
                     /db_xref="GeneID:219899"
                     /db_xref="HGNC:28115"
                     /db_xref="MIM:610451"
                     /translation="
MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVESKTK
"
     misc_feature    422..499
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
                     Region: LRR 1"
     misc_feature    500..574
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
                     Region: LRR 2"
     misc_feature    575..646
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
                     Region: LRR 3"
     misc_feature    653..721
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
                     Region: LRR 4"
     misc_feature    722..796
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
                     Region: LRR 5"
     misc_feature    725..856
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /note="Leucine Rich repeats (2 copies); Region: LRR_4;
                     pfam12799"
                     /db_xref="CDD:205079"
     misc_feature    800..877
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
                     Region: LRR 6"
     misc_feature    881..955
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
                     Region: LRR 7"
     misc_feature    1238..1462
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /note="Ubiquitin-like proteins; Region: UBQ; cl00155"
                     /db_xref="CDD:212176"
     misc_feature    order(1310..1312,1355..1357)
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /note="charged pocket; other site"
                     /db_xref="CDD:176352"
     misc_feature    1361..1372
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /note="hydrophobic patch; other site"
                     /db_xref="CDD:176352"
     variation       253
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372493054"
     variation       279
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138695287"
     variation       289
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114354179"
     variation       293
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376097465"
     variation       304
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150702205"
     variation       312
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185489274"
     exon            339..478
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /inference="alignment:Splign:1.39.8"
     variation       356
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144833842"
     variation       427
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202229726"
     exon            479..660
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /inference="alignment:Splign:1.39.8"
     variation       479
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376267533"
     variation       606
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377422079"
     variation       640
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:140003630"
     variation       641
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:78944388"
     variation       656
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370948390"
     exon            661..917
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /inference="alignment:Splign:1.39.8"
     variation       747
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:76061220"
     variation       748
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374778286"
     variation       807
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112262968"
     variation       821
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368110919"
     variation       852
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370713023"
     variation       875
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373756527"
     variation       900
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113070356"
     exon            918..1044
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /inference="alignment:Splign:1.39.8"
     variation       925
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368859055"
     variation       937
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368689002"
     variation       938
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372851892"
     variation       1015
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:35380371"
     variation       1036
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375999211"
     exon            1045..1161
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /inference="alignment:Splign:1.39.8"
     variation       1094
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377427847"
     variation       1145
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146743853"
     exon            1162..4031
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /inference="alignment:Splign:1.39.8"
     variation       1234
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368786975"
     variation       1255
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372272358"
     variation       1259
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139578794"
     variation       1280
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144345151"
     variation       1303
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146540306"
     variation       1335
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375282149"
     variation       1336
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140041201"
     variation       1375
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142279664"
     variation       1418
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373338413"
     variation       1423
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151214090"
     variation       1559
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11602226"
     variation       1898
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:112522932"
     variation       1932
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187013426"
     variation       1948
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:192223056"
     variation       1965..1966
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:376175003"
     variation       1965
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:78898111"
     variation       1965
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="gt"
                     /db_xref="dbSNP:374037889"
     variation       2020..2021
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:35880364"
     variation       2183
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:35274310"
     variation       2192
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368819132"
     variation       2360
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182842834"
     variation       2376
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:151150784"
     variation       2421
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:188225607"
     variation       2465
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:193272452"
     variation       2476
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:7109612"
     variation       2605
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185388669"
     variation       2632
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369691016"
     variation       2713
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1063101"
     variation       2737
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111981178"
     variation       2843
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:140115272"
     variation       2900
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11218139"
     variation       3049
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:189501439"
     variation       3138
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:17124764"
     variation       3258
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:114126817"
     variation       3270
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111781066"
     variation       3306
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:112596169"
     variation       3311
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377402403"
     variation       3355
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:137987759"
     variation       3381
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:147288817"
     variation       3395
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:35834454"
     variation       3475
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2298491"
     variation       3633
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191396363"
     variation       3729
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75050717"
     variation       3826..3828
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace=""
                     /replace="aat"
                     /db_xref="dbSNP:370560199"
     variation       3834
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:184340231"
     variation       3862
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111848290"
     variation       3932
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188593117"
     variation       3979
                     /gene="TBCEL"
                     /gene_synonym="El; LRRC35"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367758300"
ORIGIN      
ttccgggtcaatgcaggacactgggctccggcggccagagtgggggactaggtgaagcggcgccgggccggggctggccgggaccaggcccgaggctgagcggcggcgacagcggtggccgggaggggggaggagaggcgcagccagaggagccgccgcagtagctcccccgcctcccgggctgagggcattttaagaaagaaagatggatcaacctagtggaagaagtttcatgcaagtattatgtgaaaaatatagtcctgaaaattttccttatcgccgtggcccggggatgggagtccatgtcccagccacacctcagggctctcctatgaaagatcgcctcaacctcccaagtgtactagtgttgaacagctgtggaataacctgtgcaggagatgaaaaagaaattgctgctttctgcgctcatgtgtcggaactagatctttctgacaacaaactcgaagactggcatgaggtcagtaaaattgtgtcaaatgttcctcagttggagtttctaaacctgagttccaaccctctgaatttgtcggttttagaaagaacatgtgctgggtccttctctggggttcgcaaacttgtcctcaacaacagcaaagcttcttgggagacggtccacatgatactacaggagttaccagatttggaggagctcttcctgtgccttaatgactatgaaacagtgtcttgtccttctatttgctgtcattctcttaagctactacatataacagacaataacctccaagactggactgaaatacgaaagttaggagttatgtttccttcactggataccctcgtcctggccaacaatcatttgaatgctattgaggagcctgatgattcattggccaggttgtttcctaatcttcgatccatcagcctccacaagtcaggtttgcagtcctgggaagacattgataaactaaattcatttcccaaactggaagaagtgagattgttaggaattcctcttctgcagccatataccaccgaggagcgaaggaaattggtaatagccagattgccatcagtttccaaacttaatggcagcgttgttactgatggtgaacgagaagattctgagagattttttattcgttactatgtggatgttccacaggaagaagtgccattcaggtatcatgaactgatcactaaatatgggaagttggagcctttggcagaagtggacctaagaccccagagcagtgcaaaagtagaagtccactttaacgatcaggtggaagaaatgagcattcgtctggaccaaacagtggcagaactaaagaaacagttaaaaactctagtacaattacccacaagcaacatgcttctctactattttgaccatgaagcaccctttggcccagaggaaatgaagtacagctctcgggcattgcattcctttggcattagggatggagataaaatttacgtggaatccaaaacaaaataacctctaccagccttgtgaaaaacatacacataaggacttgttgcagggcatttgtttttaatgtggttttctttaggagggagaggttgtttttgttttgttttgttctgtttaggtttgggaaggattttgtatatttttccccctggagtgagtaggggccatttttgggtgttttctaccacagattgatttggctcagccagcggaattggccacatttccagtgtatgtgccctctctaaggaaagatgacaaagaaatcaccgacttcttactgtgttcactgggatttgcctgccacttggttatcattactgttgggtgaacctgtgaagataacatgaacactgtagccccttagaagggtctcatagagaatttaaacagggtgacaaggaatcttcacaggaagggccagaacttctctctcccagttcttccttccgctaccctccctccttggcttttttggttcagttccatttttttttcattttgacatgtggtttacctaatagttttgttctgttcataattcttatttctcaacctgggtgatttttttgttctcatttctcccttttgaaataattgaaagtgttttaagcatttttaacctgattctaatctcaggtacgcagtaagaagctataactctgttagaacctcgaagagtagatgtagaatgaaaactccaggaaaacttgcagttattctggaagcaccggcagaacagtctgatctctttgtatgttactaactcacttttaatgtccctgtacattatgtcagccattactttcataacatgaaatatgtcagattccagagttcttttatttttgcttattgaatgtatttcctcatatctttctttttcattactttaaactattgggaattgaggcctgacttcataaataattcaatagagtcctggatacgtgcaccaggagagttgagaattagctcataaactatctgtggtgtgtgtggggaatgaagttgggggatgtgggggaagagcttatgactttcccacctgtgtcatccattggaagcccttgctcttgcactttgcattaaaagtgggaaacattaatcaaagggagattttattcccaggttttccctgggactttgtgatatcataattgaacagttcttttgttttacatttcaatttagttgcctcatagaagtataactgcccaatctatgagtaaagtgtaagtgtcaaaactttacaattgcctccaagtcatattttttgcagaagcacatttaaagcacttttctgtaaaagctagttccttacctgcttggaaatctttttgtttgttcttctattcctttgttaatcagatgtaatccctttctttaatgtgtatttttcttggtccaccatgtttacagatgggagacttgagagatacttagcataactggggcagaaagtgtgtaagtgaagtatttttcaaagaatgcagttattatctgattgcatttgaccttttgacctttgttacataattctacccctcctacaaatttaatttttttatgaaatttttaggtgacttgtaaattcttcatgtatgaggagttgtgtttattaatgctactttttaaattttcctgtgccatgtggcagatgtttattctcttaatgcacttcaggtttgctatctgtaaagcctttgacccaggcctactgagtcaaatctacattcagtgtaacattaaaggtggaaaccaaagggtttgagaaagacgaataaggcctattctccttctgctgcagactttatctttcaaaatcataaaaatgagcaatggagatccaggctgggtatagacaagaataattattttgcaaacacattttcctgacagatttttggaagtaggaaaaaagtatggcaacagtgtcatgaagattgaaactgtaggtgctttgtgtatgtatgcatgagtgcagatgagtttgagagagaaaaagtgtaattgagccctttgcttttgtcagcctgggaaacagatgcgttcttattttttgaagttgtgtgaccctggactgtcccacagcagaaggcagaacaaacacttatgttatgctttaatcataagtggaatggtcacaattaataagatattttatatatggcaaagttttatgaaatgcttttttactattagagacctgtttcttctgttattacagaacacagtgtttatcaactgcggacataattcttttattatacagttgcatgtaaagggagcttctcatttaattcagcggatgtgggtatttttagggcattgtaattgatggttttaataattgctgaataatttttgattaagagaaaaatgtaatacaattactggtctgagttacagaacagaagttaatgaaaaaggctatttgagcatgtgtacttatagattcatttgggtggctgagaaaagatgctgcttttgaaataaaattggtgctgtgtagacacttgtaaccaaaattatttttataacagaactaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:219899 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
            GeneID:219899 -> Cellular component: GO:0005856 [cytoskeleton] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.