Home |
Help |
Advanced search
2025-05-09 20:12:06, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_152715 4041 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens tubulin folding cofactor E-like (TBCEL), transcript
variant 1, mRNA.
ACCESSION NM_152715
VERSION NM_152715.3 GI:194239698
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 4041)
AUTHORS Sellin,M.E., Holmfeldt,P., Stenmark,S. and Gullberg,M.
TITLE Op18/Stathmin counteracts the activity of overexpressed
tubulin-disrupting proteins in a human leukemia cell line
JOURNAL Exp. Cell Res. 314 (6), 1367-1377 (2008)
PUBMED 18262179
REMARK GeneRIF: Depletion of Op18 by means of RNA interference increased
the susceptibility of tubulin to TBCE or E-like mediated
disruption, while overexpressed Op18 exerted a tubulin-protective
effect.
REFERENCE 2 (bases 1 to 4041)
AUTHORS Bartolini,F., Tian,G., Piehl,M., Cassimeris,L., Lewis,S.A. and
Cowan,N.J.
TITLE Identification of a novel tubulin-destabilizing protein related to
the chaperone cofactor E
JOURNAL J. Cell. Sci. 118 (PT 6), 1197-1207 (2005)
PUBMED 15728251
REMARK GeneRIF: Leucine rich repeat containing 35 (E-like) is a novel
regulator of tubulin stability with overexpression causing
depolymerization of microtubules and suppression resulting in an
increase in the number of stable microtubules.
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
DB481993.2, AY398644.1, BC020501.1, DN602255.1, AI128257.1 and
BX091943.1.
On Jul 12, 2008 this sequence version replaced gi:56693214.
Transcript Variant: This variant (1) represents the longer
transcript. Variants 1 and 2 encode the same protein.
##Evidence-Data-START##
Transcript exon combination :: AY398644.1, AK295673.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025083, ERS025084 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-17 DB481993.2 1-17
18-880 AY398644.1 1-863
881-2899 BC020501.1 790-2808
2900-3355 DN602255.1 355-810
3356-3623 AI128257.1 40-307 c
3624-4041 BX091943.1 1-418 c
FEATURES Location/Qualifiers
source 1..4041
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="11"
/map="11q23.3"
gene 1..4041
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/note="tubulin folding cofactor E-like"
/db_xref="GeneID:219899"
/db_xref="HGNC:28115"
/db_xref="MIM:610451"
exon 1..188
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/inference="alignment:Splign:1.39.8"
variation 18
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="t"
/db_xref="dbSNP:370834296"
variation 71
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:11606542"
variation 73
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:374216654"
exon 189..338
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/inference="alignment:Splign:1.39.8"
misc_feature 194..196
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/note="upstream in-frame stop codon"
CDS 206..1480
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/note="catastrophin; leucine rich repeat containing 35;
tubulin-specific chaperone e-like; E-like; leucine-rich
repeat-containing protein 35"
/codon_start=1
/product="tubulin-specific chaperone cofactor E-like
protein"
/protein_id="NP_689928.3"
/db_xref="GI:194239699"
/db_xref="CCDS:CCDS31692.1"
/db_xref="GeneID:219899"
/db_xref="HGNC:28115"
/db_xref="MIM:610451"
/translation="
MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVESKTK
"
misc_feature 422..499
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
Region: LRR 1"
misc_feature 500..574
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
Region: LRR 2"
misc_feature 575..646
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
Region: LRR 3"
misc_feature 653..721
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
Region: LRR 4"
misc_feature 722..796
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
Region: LRR 5"
misc_feature 725..856
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/note="Leucine Rich repeats (2 copies); Region: LRR_4;
pfam12799"
/db_xref="CDD:205079"
misc_feature 800..877
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
Region: LRR 6"
misc_feature 881..955
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q5QJ74.2);
Region: LRR 7"
misc_feature 1238..1462
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/note="Ubiquitin-like proteins; Region: UBQ; cl00155"
/db_xref="CDD:212176"
misc_feature order(1310..1312,1355..1357)
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/note="charged pocket; other site"
/db_xref="CDD:176352"
misc_feature 1361..1372
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/note="hydrophobic patch; other site"
/db_xref="CDD:176352"
variation 253
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:372493054"
variation 279
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="g"
/db_xref="dbSNP:138695287"
variation 289
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:114354179"
variation 293
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:376097465"
variation 304
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:150702205"
variation 312
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:185489274"
exon 339..478
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/inference="alignment:Splign:1.39.8"
variation 356
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:144833842"
variation 427
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:202229726"
exon 479..660
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/inference="alignment:Splign:1.39.8"
variation 479
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:376267533"
variation 606
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:377422079"
variation 640
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="g"
/replace="t"
/db_xref="dbSNP:140003630"
variation 641
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="t"
/db_xref="dbSNP:78944388"
variation 656
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:370948390"
exon 661..917
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/inference="alignment:Splign:1.39.8"
variation 747
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="t"
/db_xref="dbSNP:76061220"
variation 748
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:374778286"
variation 807
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:112262968"
variation 821
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:368110919"
variation 852
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="c"
/db_xref="dbSNP:370713023"
variation 875
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:373756527"
variation 900
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:113070356"
exon 918..1044
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/inference="alignment:Splign:1.39.8"
variation 925
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:368859055"
variation 937
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:368689002"
variation 938
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:372851892"
variation 1015
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:35380371"
variation 1036
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:375999211"
exon 1045..1161
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/inference="alignment:Splign:1.39.8"
variation 1094
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:377427847"
variation 1145
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:146743853"
exon 1162..4031
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/inference="alignment:Splign:1.39.8"
variation 1234
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:368786975"
variation 1255
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:372272358"
variation 1259
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:139578794"
variation 1280
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:144345151"
variation 1303
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:146540306"
variation 1335
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:375282149"
variation 1336
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:140041201"
variation 1375
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:142279664"
variation 1418
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:373338413"
variation 1423
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:151214090"
variation 1559
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:11602226"
variation 1898
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="c"
/db_xref="dbSNP:112522932"
variation 1932
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:187013426"
variation 1948
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:192223056"
variation 1965..1966
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace=""
/replace="t"
/db_xref="dbSNP:376175003"
variation 1965
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:78898111"
variation 1965
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="gt"
/db_xref="dbSNP:374037889"
variation 2020..2021
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace=""
/replace="a"
/db_xref="dbSNP:35880364"
variation 2183
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace=""
/replace="a"
/db_xref="dbSNP:35274310"
variation 2192
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:368819132"
variation 2360
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:182842834"
variation 2376
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="g"
/replace="t"
/db_xref="dbSNP:151150784"
variation 2421
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="t"
/db_xref="dbSNP:188225607"
variation 2465
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:193272452"
variation 2476
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:7109612"
variation 2605
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:185388669"
variation 2632
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:369691016"
variation 2713
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:1063101"
variation 2737
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:111981178"
variation 2843
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="c"
/db_xref="dbSNP:140115272"
variation 2900
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:11218139"
variation 3049
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="g"
/replace="t"
/db_xref="dbSNP:189501439"
variation 3138
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="t"
/db_xref="dbSNP:17124764"
variation 3258
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:114126817"
variation 3270
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:111781066"
variation 3306
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="t"
/db_xref="dbSNP:112596169"
variation 3311
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:377402403"
variation 3355
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:137987759"
variation 3381
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace=""
/replace="t"
/db_xref="dbSNP:147288817"
variation 3395
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace=""
/replace="a"
/db_xref="dbSNP:35834454"
variation 3475
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:2298491"
variation 3633
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:191396363"
variation 3729
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:75050717"
variation 3826..3828
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace=""
/replace="aat"
/db_xref="dbSNP:370560199"
variation 3834
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="c"
/db_xref="dbSNP:184340231"
variation 3862
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="a"
/replace="g"
/db_xref="dbSNP:111848290"
variation 3932
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:188593117"
variation 3979
/gene="TBCEL"
/gene_synonym="El; LRRC35"
/replace="c"
/replace="t"
/db_xref="dbSNP:367758300"
ORIGIN
ttccgggtcaatgcaggacactgggctccggcggccagagtgggggactaggtgaagcggcgccgggccggggctggccgggaccaggcccgaggctgagcggcggcgacagcggtggccgggaggggggaggagaggcgcagccagaggagccgccgcagtagctcccccgcctcccgggctgagggcattttaagaaagaaagatggatcaacctagtggaagaagtttcatgcaagtattatgtgaaaaatatagtcctgaaaattttccttatcgccgtggcccggggatgggagtccatgtcccagccacacctcagggctctcctatgaaagatcgcctcaacctcccaagtgtactagtgttgaacagctgtggaataacctgtgcaggagatgaaaaagaaattgctgctttctgcgctcatgtgtcggaactagatctttctgacaacaaactcgaagactggcatgaggtcagtaaaattgtgtcaaatgttcctcagttggagtttctaaacctgagttccaaccctctgaatttgtcggttttagaaagaacatgtgctgggtccttctctggggttcgcaaacttgtcctcaacaacagcaaagcttcttgggagacggtccacatgatactacaggagttaccagatttggaggagctcttcctgtgccttaatgactatgaaacagtgtcttgtccttctatttgctgtcattctcttaagctactacatataacagacaataacctccaagactggactgaaatacgaaagttaggagttatgtttccttcactggataccctcgtcctggccaacaatcatttgaatgctattgaggagcctgatgattcattggccaggttgtttcctaatcttcgatccatcagcctccacaagtcaggtttgcagtcctgggaagacattgataaactaaattcatttcccaaactggaagaagtgagattgttaggaattcctcttctgcagccatataccaccgaggagcgaaggaaattggtaatagccagattgccatcagtttccaaacttaatggcagcgttgttactgatggtgaacgagaagattctgagagattttttattcgttactatgtggatgttccacaggaagaagtgccattcaggtatcatgaactgatcactaaatatgggaagttggagcctttggcagaagtggacctaagaccccagagcagtgcaaaagtagaagtccactttaacgatcaggtggaagaaatgagcattcgtctggaccaaacagtggcagaactaaagaaacagttaaaaactctagtacaattacccacaagcaacatgcttctctactattttgaccatgaagcaccctttggcccagaggaaatgaagtacagctctcgggcattgcattcctttggcattagggatggagataaaatttacgtggaatccaaaacaaaataacctctaccagccttgtgaaaaacatacacataaggacttgttgcagggcatttgtttttaatgtggttttctttaggagggagaggttgtttttgttttgttttgttctgtttaggtttgggaaggattttgtatatttttccccctggagtgagtaggggccatttttgggtgttttctaccacagattgatttggctcagccagcggaattggccacatttccagtgtatgtgccctctctaaggaaagatgacaaagaaatcaccgacttcttactgtgttcactgggatttgcctgccacttggttatcattactgttgggtgaacctgtgaagataacatgaacactgtagccccttagaagggtctcatagagaatttaaacagggtgacaaggaatcttcacaggaagggccagaacttctctctcccagttcttccttccgctaccctccctccttggcttttttggttcagttccatttttttttcattttgacatgtggtttacctaatagttttgttctgttcataattcttatttctcaacctgggtgatttttttgttctcatttctcccttttgaaataattgaaagtgttttaagcatttttaacctgattctaatctcaggtacgcagtaagaagctataactctgttagaacctcgaagagtagatgtagaatgaaaactccaggaaaacttgcagttattctggaagcaccggcagaacagtctgatctctttgtatgttactaactcacttttaatgtccctgtacattatgtcagccattactttcataacatgaaatatgtcagattccagagttcttttatttttgcttattgaatgtatttcctcatatctttctttttcattactttaaactattgggaattgaggcctgacttcataaataattcaatagagtcctggatacgtgcaccaggagagttgagaattagctcataaactatctgtggtgtgtgtggggaatgaagttgggggatgtgggggaagagcttatgactttcccacctgtgtcatccattggaagcccttgctcttgcactttgcattaaaagtgggaaacattaatcaaagggagattttattcccaggttttccctgggactttgtgatatcataattgaacagttcttttgttttacatttcaatttagttgcctcatagaagtataactgcccaatctatgagtaaagtgtaagtgtcaaaactttacaattgcctccaagtcatattttttgcagaagcacatttaaagcacttttctgtaaaagctagttccttacctgcttggaaatctttttgtttgttcttctattcctttgttaatcagatgtaatccctttctttaatgtgtatttttcttggtccaccatgtttacagatgggagacttgagagatacttagcataactggggcagaaagtgtgtaagtgaagtatttttcaaagaatgcagttattatctgattgcatttgaccttttgacctttgttacataattctacccctcctacaaatttaatttttttatgaaatttttaggtgacttgtaaattcttcatgtatgaggagttgtgtttattaatgctactttttaaattttcctgtgccatgtggcagatgtttattctcttaatgcacttcaggtttgctatctgtaaagcctttgacccaggcctactgagtcaaatctacattcagtgtaacattaaaggtggaaaccaaagggtttgagaaagacgaataaggcctattctccttctgctgcagactttatctttcaaaatcataaaaatgagcaatggagatccaggctgggtatagacaagaataattattttgcaaacacattttcctgacagatttttggaagtaggaaaaaagtatggcaacagtgtcatgaagattgaaactgtaggtgctttgtgtatgtatgcatgagtgcagatgagtttgagagagaaaaagtgtaattgagccctttgcttttgtcagcctgggaaacagatgcgttcttattttttgaagttgtgtgaccctggactgtcccacagcagaaggcagaacaaacacttatgttatgctttaatcataagtggaatggtcacaattaataagatattttatatatggcaaagttttatgaaatgcttttttactattagagacctgtttcttctgttattacagaacacagtgtttatcaactgcggacataattcttttattatacagttgcatgtaaagggagcttctcatttaattcagcggatgtgggtatttttagggcattgtaattgatggttttaataattgctgaataatttttgattaagagaaaaatgtaatacaattactggtctgagttacagaacagaagttaatgaaaaaggctatttgagcatgtgtacttatagattcatttgggtggctgagaaaagatgctgcttttgaaataaaattggtgctgtgtagacacttgtaaccaaaattatttttataacagaactaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:219899 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
GeneID:219899 -> Cellular component: GO:0005856 [cytoskeleton] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.