Home |
Help |
Advanced search
2025-05-09 20:18:04, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_138484 1548 bp mRNA linear PRI 14-APR-2013
DEFINITION Homo sapiens shugoshin-like 1 (S. pombe) (SGOL1), transcript
variant C2, mRNA.
ACCESSION NM_138484
VERSION NM_138484.3 GI:312922398
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1548)
AUTHORS Greenwood,T.A., Akiskal,H.S., Akiskal,K.K. and Kelsoe,J.R.
CONSRTM Bipolar Genome Study
TITLE Genome-wide association study of temperament in bipolar disorder
reveals significant associations with three novel Loci
JOURNAL Biol. Psychiatry 72 (4), 303-310 (2012)
PUBMED 22365631
REFERENCE 2 (bases 1 to 1548)
AUTHORS Liu,L., Zhang,N., Liu,J., Min,J., Ma,N., Liu,N., Liu,Y. and
Zhang,H.
TITLE Lentivirus-mediated siRNA interference targeting SGO-1 inhibits
human NSCLC cell growth
JOURNAL Tumour Biol. 33 (2), 515-521 (2012)
PUBMED 22161216
REMARK GeneRIF: Lentivirus-mediated siRNA interference targeting SGO-1
inhibits human NSCLC cell growth
REFERENCE 3 (bases 1 to 1548)
AUTHORS Kahyo,T., Iwaizumi,M., Shinmura,K., Matsuura,S., Nakamura,T.,
Watanabe,Y., Yamada,H. and Sugimura,H.
TITLE A novel tumor-derived SGOL1 variant causes abnormal mitosis and
unstable chromatid cohesion
JOURNAL Oncogene 30 (44), 4453-4463 (2011)
PUBMED 21532624
REMARK GeneRIF: These results suggest that SGOL1-P1 may function as a
negative factor to native SGOL1, and that abundant expression of
SGOL1-P1 may be responsible for chromosomal instability.
REFERENCE 4 (bases 1 to 1548)
AUTHORS Kang,J., Chaudhary,J., Dong,H., Kim,S., Brautigam,C.A. and Yu,H.
TITLE Mitotic centromeric targeting of HP1 and its binding to Sgo1 are
dispensable for sister-chromatid cohesion in human cells
JOURNAL Mol. Biol. Cell 22 (8), 1181-1190 (2011)
PUBMED 21346195
REMARK GeneRIF: HP1alpha binding by INCENP or Shugoshin 1 (Sgo1) is
dispensable for centromeric cohesion protection during mitosis of
human cells, but might regulate yet unknown interphase functions of
the chromosome passenger complex (CPC) or Sgo1 at the centromeres.
REFERENCE 5 (bases 1 to 1548)
AUTHORS Okamoto,N., Kuwahara,K., Ohta,K., Kitabatake,M., Takagi,K.,
Mizuta,H., Kondo,E. and Sakaguchi,N.
TITLE Germinal center-associated nuclear protein (GANP) is involved in
mRNA export of Shugoshin-1 required for centromere cohesion and in
sister-chromatid exchange
JOURNAL Genes Cells 15 (5), 471-484 (2010)
PUBMED 20384790
REMARK GeneRIF: Data show that human germinal center-associated nuclear
protein (GANP) is critically involved in cell proliferation at the
mitotic phase through its selective support of shugoshin-1 mRNA
export.
REFERENCE 6 (bases 1 to 1548)
AUTHORS Wang,X. and Dai,W.
TITLE Shugoshin, a guardian for sister chromatid segregation
JOURNAL Exp. Cell Res. 310 (1), 1-9 (2005)
PUBMED 16112668
REMARK GeneRIF: A comprehensive review of Sgo1 function in eukaryote at
meiosis and mitosis.
Review article
REFERENCE 7 (bases 1 to 1548)
AUTHORS McGuinness,B.E., Hirota,T., Kudo,N.R., Peters,J.M. and Nasmyth,K.
TITLE Shugoshin prevents dissociation of cohesin from centromeres during
mitosis in vertebrate cells
JOURNAL PLoS Biol. 3 (3), E86 (2005)
PUBMED 15737064
REMARK GeneRIF: A shugoshin-like protein associates with centromeres
during prophase and disappears at the onset of anaphase
REFERENCE 8 (bases 1 to 1548)
AUTHORS Kitajima,T.S., Hauf,S., Ohsugi,M., Yamamoto,T. and Watanabe,Y.
TITLE Human Bub1 defines the persistent cohesion site along the mitotic
chromosome by affecting Shugoshin localization
JOURNAL Curr. Biol. 15 (4), 353-359 (2005)
PUBMED 15723797
REFERENCE 9 (bases 1 to 1548)
AUTHORS Tang,Z., Sun,Y., Harley,S.E., Zou,H. and Yu,H.
TITLE Human Bub1 protects centromeric sister-chromatid cohesion through
Shugoshin during mitosis
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (52), 18012-18017 (2004)
PUBMED 15604152
REMARK GeneRIF: Bub1 protects centromeric cohesion through Shugoshin in
mitosis
REFERENCE 10 (bases 1 to 1548)
AUTHORS Scanlan,M.J., Gout,I., Gordon,C.M., Williamson,B., Stockert,E.,
Gure,A.O., Jager,D., Chen,Y.T., Mackay,A., O'Hare,M.J. and Old,L.J.
TITLE Humoral immunity to human breast cancer: antigen definition and
quantitative analysis of mRNA expression
JOURNAL Cancer Immun. 1, 4 (2001)
PUBMED 12747765
REMARK Publication Status: Online-Only
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
BG530826.1, AB193056.1 and AB187582.1.
On Nov 30, 2010 this sequence version replaced gi:142359926.
Transcript Variant: This variant (C2) lacks an in-frame internal
exon, as compared to variant A2. The resulting isoform (C2, also
known as 1KL) lacks an internal segment, as compared to isoform A2.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC017867.1, AB193066.1 [ECO:0000332]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-153 BG530826.1 2-154
154-912 AB193056.1 186-944
913-1548 AB187582.1 898-1533
FEATURES Location/Qualifiers
source 1..1548
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="3"
/map="3p24.3"
gene 1..1548
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/note="shugoshin-like 1 (S. pombe)"
/db_xref="GeneID:151648"
/db_xref="HGNC:25088"
/db_xref="HPRD:12377"
/db_xref="MIM:609168"
exon 1..148
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/inference="alignment:Splign:1.39.8"
variation complement(4)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="t"
/db_xref="dbSNP:145702873"
variation complement(36)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="g"
/replace="t"
/db_xref="dbSNP:370108487"
variation complement(45)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:375306760"
variation complement(53)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:140520229"
variation complement(60)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:151299371"
misc_feature 138..140
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/note="upstream in-frame stop codon"
exon 149..297
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/inference="alignment:Splign:1.39.8"
CDS 156..1034
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/note="isoform C2 is encoded by transcript variant C2;
shugoshin 1AB protein; shugoshin 1CD protein; shugoshin
1EF protein; shugoshin 1GH protein; shugoshin 1KL protein;
hSgo1; serologically defined breast cancer antigen
NY-BR-85"
/codon_start=1
/product="shugoshin-like 1 isoform C2"
/protein_id="NP_612493.1"
/db_xref="GI:24308448"
/db_xref="CCDS:CCDS2635.1"
/db_xref="GeneID:151648"
/db_xref="HGNC:25088"
/db_xref="HPRD:12377"
/db_xref="MIM:609168"
/translation="
MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR
"
misc_feature 219..356
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/note="Shugoshin N-terminal coiled-coil region; Region:
Shugoshin_N; pfam07558"
/db_xref="CDD:203682"
misc_feature 759..836
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/note="Shugoshin C terminus; Region: Shugoshin_C;
pfam07557"
/db_xref="CDD:191783"
variation complement(185)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="c"
/db_xref="dbSNP:143768051"
variation complement(217)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:374022493"
variation complement(222)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:199815268"
variation complement(246)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="g"
/replace="t"
/db_xref="dbSNP:140691683"
variation complement(248)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:202081733"
variation complement(254)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="t"
/db_xref="dbSNP:113892853"
variation complement(261)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="t"
/db_xref="dbSNP:377471833"
variation complement(269)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="g"
/replace="t"
/db_xref="dbSNP:143576733"
variation complement(282)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="t"
/db_xref="dbSNP:145234403"
variation complement(291)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:150552043"
exon 298..494
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/inference="alignment:Splign:1.39.8"
variation complement(316)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="t"
/db_xref="dbSNP:192601368"
variation complement(329)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:200787365"
variation complement(345)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="t"
/db_xref="dbSNP:189746950"
variation complement(393)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="g"
/db_xref="dbSNP:145242036"
variation complement(397)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="t"
/db_xref="dbSNP:201174493"
variation complement(445)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:202028804"
variation complement(467)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="c"
/db_xref="dbSNP:369840848"
variation complement(479)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="c"
/db_xref="dbSNP:375511922"
variation complement(489)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:183736430"
exon 495..571
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/inference="alignment:Splign:1.39.8"
variation complement(520)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="t"
/db_xref="dbSNP:148317477"
variation complement(568)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="t"
/db_xref="dbSNP:147441982"
exon 572..630
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/inference="alignment:Splign:1.39.8"
exon 631..820
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/inference="alignment:Splign:1.39.8"
variation complement(653)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:368034531"
variation complement(666)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:375090371"
variation complement(671)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="g"
/db_xref="dbSNP:199965073"
variation complement(678)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:139053195"
variation complement(685)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:139869512"
variation complement(703)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="t"
/db_xref="dbSNP:146108565"
variation complement(734)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="c"
/db_xref="dbSNP:75326306"
variation complement(767)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:113607987"
variation complement(791)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="t"
/db_xref="dbSNP:149344897"
variation complement(792)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:372402306"
variation complement(808)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="c"
/db_xref="dbSNP:181464459"
exon 821..912
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/inference="alignment:Splign:1.39.8"
variation complement(822)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="c"
/db_xref="dbSNP:13060316"
variation complement(884)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:200039832"
variation complement(901)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:77194360"
exon 913..1546
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/inference="alignment:Splign:1.39.8"
variation complement(916)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="t"
/db_xref="dbSNP:199603756"
variation complement(921)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:369926768"
variation complement(967)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="g"
/db_xref="dbSNP:368430426"
variation complement(980)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:151004231"
variation complement(985)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="t"
/db_xref="dbSNP:200770059"
variation complement(993)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="t"
/db_xref="dbSNP:148485165"
variation complement(994)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:375535687"
variation complement(1015)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="t"
/db_xref="dbSNP:139865348"
variation complement(1034..1036)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace=""
/replace="aag"
/db_xref="dbSNP:147648109"
variation complement(1051)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:368161123"
variation complement(1060..1061)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace=""
/replace="tt"
/db_xref="dbSNP:200745858"
variation complement(1078)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="t"
/db_xref="dbSNP:374709212"
variation complement(1079)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:370945018"
variation complement(1107)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:191550560"
variation complement(1127)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="g"
/db_xref="dbSNP:185656328"
variation complement(1388)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="t"
/db_xref="dbSNP:140309229"
variation complement(1402)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="t"
/db_xref="dbSNP:138585609"
variation complement(1422)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="g"
/db_xref="dbSNP:182471636"
variation complement(1448)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="a"
/replace="t"
/db_xref="dbSNP:189655218"
variation complement(1519)
/gene="SGOL1"
/gene_synonym="NY-BR-85; SGO; Sgo1"
/replace="c"
/replace="g"
/db_xref="dbSNP:150147188"
ORIGIN
gaatgtggcggcggtagttccaggcgacggcggacggtggtacggtcctggagggcccagtgcgcggggctagccgtggctggagagcttcgaagagccttgaaatgtgaggaggaggaagatagctgttgcagaagtagtggccaaggcaaaagatggccaaggaaagatgcctgaaaaagtcctttcaagatagtcttgaagacataaagaagcgaatgaaagagaaaaggaataaaaacttggcagagattggcaaacgcaggtcttttatagctgcaccatgccaaataatcaccaacacttctacactgctgaaaaattaccaagacaacaacaaaatgttagttttagctttggaaaatgaaaaatccaaagtgaaagaagcccaagatatcatcctacagctgagaaaagaatgttactatctcacatgtcagctatatgcattgaaaggaaaacttacatcacaacaaacagtagaacctgctcagaaccaggaaatatgttcctctggaatggaccccaatagtgatgacagctccagaaatttatttgtgaaggatttaccgcaaattcctcttgaagaaactgaacttccaggacaaggagaatcatttcaaatagaagctacaccacctgaaactcagcagtcacctcatcttagcctgaaggatatcaccaatgtctccttgtatcctgttgtgaaaatcagaagactttctctttctccaaaaaagaataaagcaagcccagcagtggctctgcctaaacgtaggtgcacagccagcgtgaactataaggagcccaccctcgcttcgaaactgagaagaggggacccttttacagatttgtgttttttgaattctcctattttcaagcagaaaaaggatttgagacgttctaaaaaaagagccctggaggtatcacctgccaaagaagcaatttttattttatattatgttcgagaatttgtttcgagattcccagactgtaggaaatgtaaacttgaaacccacatctgcttgaggtaaagtccacgggcttcacatccttagaaaacttttttagtccatgcattcactaatgtatgcagacctttaatagattctagctttatgtgttgggggagagatggaggggtgttgacagtctgtttcactcagcctacatacataataaaatctaagccctttaattagagatagcaactttcccagggtgaccgaggaatcagtacgtgttgaacccctcttttaagtttccttttggttgtgtcacttggagattgccttttctttcttgtaagctcagctgtgtcctcaaatatattgcattttacccagcatttccaggtgttttcaggggtcaaagtttttaagttatcttagtctttgatattgtgtaagcgaaattctccaatcccatctcctagatgatttttttttaaatcacaaaatgtgattatgcttaacagctgtttcctgtttctcttaaaataaaatccatttcctatttctcttaaaataaaatccattattcttaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:151648 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:151648 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:151648 -> Biological process: GO:0007059 [chromosome segregation] evidence: IDA
GeneID:151648 -> Biological process: GO:0007067 [mitosis] evidence: IEA
GeneID:151648 -> Biological process: GO:0008608 [attachment of spindle microtubules to kinetochore] evidence: IDA
GeneID:151648 -> Biological process: GO:0010457 [centriole-centriole cohesion] evidence: IDA
GeneID:151648 -> Biological process: GO:0045132 [meiotic chromosome segregation] evidence: IEA
GeneID:151648 -> Biological process: GO:0051301 [cell division] evidence: IEA
GeneID:151648 -> Cellular component: GO:0000775 [chromosome, centromeric region] evidence: IDA
GeneID:151648 -> Cellular component: GO:0000776 [kinetochore] evidence: IDA
GeneID:151648 -> Cellular component: GO:0000777 [condensed chromosome kinetochore] evidence: IEA
GeneID:151648 -> Cellular component: GO:0000779 [condensed chromosome, centromeric region] evidence: IDA
GeneID:151648 -> Cellular component: GO:0000780 [condensed nuclear chromosome, centromeric region] evidence: IEA
GeneID:151648 -> Cellular component: GO:0000922 [spindle pole] evidence: IDA
GeneID:151648 -> Cellular component: GO:0005813 [centrosome] evidence: IDA
GeneID:151648 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:151648 -> Cellular component: GO:0030892 [mitotic cohesin complex] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.