GGRNA Home | Help | Advanced search

2025-05-09 19:09:43, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_005727               1639 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens tetraspanin 1 (TSPAN1), mRNA.
ACCESSION   NM_005727
VERSION     NM_005727.3  GI:274317624
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1639)
  AUTHORS   Wang,G.L., Chen,L., Wei,Y.Z., Zhou,J.M., Wu,Y.Y., Zhang,Y.X.,
            Qin,J. and Zhu,Y.Y.
  TITLE     The effect of NET-1 on the proliferation, migration and endocytosis
            of the SMMC-7721 HCC cell line
  JOURNAL   Oncol. Rep. 27 (6), 1944-1952 (2012)
   PUBMED   22378020
  REMARK    GeneRIF: data suggest that the NET-1 gene may play an important
            role in proliferation, migration and endocytosis in the development
            and progress of hepatocellular carcinoma
REFERENCE   2  (bases 1 to 1639)
  AUTHORS   Nabokina,S.M., Senthilkumar,S.R. and Said,H.M.
  TITLE     Tspan-1 interacts with the thiamine transporter-1 in human
            intestinal epithelial cells and modulates its stability
  JOURNAL   Am. J. Physiol. Gastrointest. Liver Physiol. 301 (5), G808-G813
            (2011)
   PUBMED   21836059
  REMARK    GeneRIF: These studies demonstrate for the first time that Tspan-1
            is an interacting partner with human thiamine transporter-1 and
            that this interaction affects thiamine transporter-1 stability.
REFERENCE   3  (bases 1 to 1639)
  AUTHORS   Huang,Y.K., Fan,X.G., Qiu,F. and Wang,Z.M.
  TITLE     Genomics of hepatitis B virus-related hepatocellular carcinoma and
            adjacent noncancerous tissues with cDNA microarray
  JOURNAL   Chin. Med. J. 124 (13), 2057-2064 (2011)
   PUBMED   22088470
  REMARK    GeneRIF: Study provided the gene expression profile of HBV-related
            HCC and presented differential expression patterns of SATB-1,
            TM4SF-1 and ST-14 between cancerous and noncancerous tissues in
            patients with HBV-related HCC.
REFERENCE   4  (bases 1 to 1639)
  AUTHORS   Chen,L., Yuan,D., Wang,G.L., Wang,Y., Wu,Y.Y. and Zhu,J.
  TITLE     Clinicopathological significance of expression of Tspan-1, Jab1 and
            p27 in human hepatocellular carcinoma
  JOURNAL   J. Korean Med. Sci. 25 (10), 1438-1442 (2010)
   PUBMED   20890423
  REMARK    GeneRIF: The overexpression of Tspan-1 was found in HCC tissues,
            positively correlated with clinical stage and negatively correlated
            with survival rate.
REFERENCE   5  (bases 1 to 1639)
  AUTHORS   Chen,L., Yuan,D., Zhao,R., Li,H. and Zhu,J.
  TITLE     Suppression of TSPAN1 by RNA interference inhibits proliferation
            and invasion of colon cancer cells in vitro
  JOURNAL   Tumori 96 (5), 744-750 (2010)
   PUBMED   21302622
  REMARK    GeneRIF: RNAi-mediated downregulation of TSPAN1 expression
            significantly inhibits the proliferation and invasion of colon
            cancer cells in vitro.
REFERENCE   6  (bases 1 to 1639)
  AUTHORS   Oh,J.H., Yang,J.O., Hahn,Y., Kim,M.R., Byun,S.S., Jeon,Y.J.,
            Kim,J.M., Song,K.S., Noh,S.M., Kim,S., Yoo,H.S., Kim,Y.S. and
            Kim,N.S.
  TITLE     Transcriptome analysis of human gastric cancer
  JOURNAL   Mamm. Genome 16 (12), 942-954 (2005)
   PUBMED   16341674
REFERENCE   7  (bases 1 to 1639)
  AUTHORS   Wollscheid,V., Kuhne-Heid,R., Stein,I., Jansen,L., Kollner,S.,
            Schneider,A. and Durst,M.
  TITLE     Identification of a new proliferation-associated protein NET-1/C4.8
            characteristic for a subset of high-grade cervical intraepithelial
            neoplasia and cervical carcinomas
  JOURNAL   Int. J. Cancer 99 (6), 771-775 (2002)
   PUBMED   12115476
  REMARK    GeneRIF: Overexpression of NET-1 is associated with
            undifferentiated squamous cell carcinoma of cervical neoplasms
REFERENCE   8  (bases 1 to 1639)
  AUTHORS   Berditchevski,F.
  TITLE     Complexes of tetraspanins with integrins: more than meets the eye
  JOURNAL   J. Cell. Sci. 114 (PT 23), 4143-4151 (2001)
   PUBMED   11739647
  REMARK    Review article
REFERENCE   9  (bases 1 to 1639)
  AUTHORS   Serru,V., Dessen,P., Boucheix,C. and Rubinstein,E.
  TITLE     Sequence and expression of seven new tetraspans
  JOURNAL   Biochim. Biophys. Acta 1478 (1), 159-163 (2000)
   PUBMED   10719184
REFERENCE   10 (bases 1 to 1639)
  AUTHORS   Todd,S.C., Doctor,V.S. and Levy,S.
  TITLE     Sequences and expression of six new members of the
            tetraspanin/TM4SF family
  JOURNAL   Biochim. Biophys. Acta 1399 (1), 101-104 (1998)
   PUBMED   9714763
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BM908049.1, AL672043.15,
            AK313774.1, AF065388.1 and BM856468.1.
            On Dec 12, 2009 this sequence version replaced gi:21264577.
            
            Summary: The protein encoded by this gene is a member of the
            transmembrane 4 superfamily, also known as the tetraspanin family.
            Most of these members are cell-surface proteins that are
            characterized by the presence of four hydrophobic domains. The
            proteins mediate signal transduction events that play a role in the
            regulation of cell development, activation, growth and motility.
            [provided by RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK313774.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025085 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-6                 BM908049.1         5-10
            7-10                AL672043.15        30864-30867
            11-1200             AK313774.1         1-1190
            1201-1625           AF065388.1         848-1272
            1626-1639           BM856468.1         261-274
FEATURES             Location/Qualifiers
     source          1..1639
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1p34.1"
     gene            1..1639
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /note="tetraspanin 1"
                     /db_xref="GeneID:10103"
                     /db_xref="HGNC:20657"
                     /db_xref="HPRD:18232"
                     /db_xref="MIM:613170"
     exon            1..333
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /inference="alignment:Splign:1.39.8"
     variation       86
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375081986"
     variation       99
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:377295877"
     exon            334..466
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /inference="alignment:Splign:1.39.8"
     variation       374
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143274549"
     misc_feature    460..462
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /note="upstream in-frame stop codon"
     exon            467..531
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /inference="alignment:Splign:1.39.8"
     CDS             475..1200
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /note="tetraspan 1"
                     /codon_start=1
                     /product="tetraspanin-1"
                     /protein_id="NP_005718.2"
                     /db_xref="GI:21264578"
                     /db_xref="CCDS:CCDS530.1"
                     /db_xref="GeneID:10103"
                     /db_xref="HGNC:20657"
                     /db_xref="HPRD:18232"
                     /db_xref="MIM:613170"
                     /translation="
MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGPLSSSAMQFVNVGYFLIAAGVVVFALGFLGCYGAKTESKCALVTFFFILLLIFIAEVAAAVVALVYTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTVGGVAAGIGGLELAAMIVSMYLYCNLQ
"
     misc_feature    490..1194
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /note="Tetraspanin family; Region: Tetraspannin;
                     pfam00335"
                     /db_xref="CDD:201163"
     misc_feature    508..570
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O60635.2);
                     transmembrane region"
     misc_feature    631..693
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O60635.2);
                     transmembrane region"
     misc_feature    739..801
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O60635.2);
                     transmembrane region"
     misc_feature    802..1107
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /note="Tetraspanin, extracellular domain or large
                     extracellular loop (LEL), uroplakin_I_like family.
                     Tetraspanins are trans-membrane proteins with 4
                     trans-membrane segments. Both the N- and C-termini lie on
                     the intracellular side of the membrane. This alignment...;
                     Region: uroplakin_I_like_LEL; cd03156"
                     /db_xref="CDD:48420"
     misc_feature    order(811..813,823..825,829..834,841..843,889..891,
                     898..903,910..915)
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:48420"
     misc_feature    895..897
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="glycosylation site"
     misc_feature    934..936
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="glycosylation site"
     misc_feature    1006..1008
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="glycosylation site"
     misc_feature    1024..1026
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="glycosylation site"
     misc_feature    1108..1170
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O60635.2);
                     transmembrane region"
     variation       475
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2234266"
     variation       505
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184135661"
     exon            532..738
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /inference="alignment:Splign:1.39.8"
     variation       533
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181648118"
     variation       560
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201704042"
     variation       587
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2234267"
     variation       591
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150230789"
     variation       603
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138700033"
     variation       632
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138801780"
     variation       664
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143584741"
     variation       666
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145996817"
     variation       667
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138721574"
     variation       672
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139002111"
     variation       714
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35000902"
     variation       733
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2234268"
     variation       737
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372580265"
     exon            739..813
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /inference="alignment:Splign:1.39.8"
     variation       743
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145702144"
     variation       793
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375028085"
     exon            814..912
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /inference="alignment:Splign:1.39.8"
     variation       831
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140948297"
     variation       899
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:41286815"
     exon            913..1068
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /inference="alignment:Splign:1.39.8"
     variation       939
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111543379"
     variation       941
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201800369"
     variation       942
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146559665"
     variation       1009
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370460447"
     variation       1039
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1047216"
     variation       1044
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201547396"
     variation       1054
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200479864"
     exon            1069..1152
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /inference="alignment:Splign:1.39.8"
     variation       1073
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370368119"
     variation       1093
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144913574"
     variation       1100
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375232447"
     variation       1116
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368462173"
     variation       1117
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149302587"
     variation       1137
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200863715"
     variation       1150
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371861627"
     exon            1153..1629
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /inference="alignment:Splign:1.39.8"
     variation       1164
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:34463133"
     variation       1176
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376073263"
     variation       1197
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147137223"
     variation       1217
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199685801"
     variation       1250
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201843939"
     variation       1253
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112015052"
     variation       1291
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1802371"
     variation       1336
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373512282"
     STS             1430..1590
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /standard_name="SHGC-74773"
                     /db_xref="UniSTS:67619"
     variation       1447
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1802372"
     variation       1473
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1802309"
     variation       1482
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:11552232"
     variation       1614
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:112046563"
     polyA_site      1629
                     /gene="TSPAN1"
                     /gene_synonym="NET1; TM4C; TM4SF"
ORIGIN      
tcccggcctcagacacacacaccagcagctacacctacacgctgaccatcacaggcacacagaggcacatccacctcacatccacctcatacttgtgtactctcagggttcagtctttcatcctatccctctctgatctgtgcctcccaataccttccaagatgtttacagagacccttctccctgtgcagttaggagtgtaaggcaagagagcccctacttcatggggcagatcaagagctgagaccaaagatggtctatgttgctgaccttgtcctgtcctcctgctgtcttaaactatgatccctgctgcggtcactgaagcctttccctgtgagcagtggtgtgtgagagccaggcgtccctctgcctgcccactcagtggcaacacccgggagctgttttgtcctttgtggagcctcagcagttccctctttcagaactcactgccaagagccctgaacaggagccaccatgcagtgcttcagcttcattaagaccatgatgatcctcttcaatttgctcatctttctgtgtggtgcagccctgttggcagtgggcatctgggtgtcaatcgatggggcatcctttctgaagatcttcgggccactgtcgtccagtgccatgcagtttgtcaacgtgggctacttcctcatcgcagccggcgttgtggtctttgctcttggtttcctgggctgctatggtgctaagactgagagcaagtgtgccctcgtgacgttcttcttcatcctcctcctcatcttcattgctgaggttgcagctgctgtggtcgccttggtgtacaccacaatggctgagcacttcctgacgttgctggtagtgcctgccatcaagaaagattatggttcccaggaagacttcactcaagtgtggaacaccaccatgaaagggctcaagtgctgtggcttcaccaactatacggattttgaggactcaccctacttcaaagagaacagtgcctttcccccattctgttgcaatgacaacgtcaccaacacagccaatgaaacctgcaccaagcaaaaggctcacgaccaaaaagtagagggttgcttcaatcagcttttgtatgacatccgaactaatgcagtcaccgtgggtggtgtggcagctggaattgggggcctcgagctggctgccatgattgtgtccatgtatctgtactgcaatctacaataagtccacttctgcctctgccactactgctgccacatgggaactgtgaagaggcaccctggcaagcagcagtgattgggggaggggacaggatctaacaatgtcacttgggccagaatggacctgccctttctgctccagacttggggctagatagggaccactccttttaggcgatgcctgactttccttccattggtgggtggatgggtggggggcattccagagcctctaaggtagccagttctgttgcccattcccccagtctattaaacccttgatatgccccctaggcctagtggtgatcccagtgctctactgggggatgagagaaaggcattttatagcctgggcataagtgaaatcagcagagcctctgggtggatgtgtagaaggcacttcaaaatgcataaacctgttacaatgttgccaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:10103 -> Cellular component: GO:0005765 [lysosomal membrane] evidence: IEA
            GeneID:10103 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.