Home |
Help |
Advanced search
2025-05-09 19:48:49, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_003118 3604 bp mRNA linear PRI 15-JUL-2013
DEFINITION Homo sapiens secreted protein, acidic, cysteine-rich (osteonectin)
(SPARC), mRNA.
ACCESSION NM_003118
VERSION NM_003118.3 GI:365777426
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 3604)
AUTHORS Said,N., Frierson,H.F., Sanchez-Carbayo,M., Brekken,R.A. and
Theodorescu,D.
TITLE Loss of SPARC in bladder cancer enhances carcinogenesis and
progression
JOURNAL J. Clin. Invest. 123 (2), 751-766 (2013)
PUBMED 23321672
REMARK GeneRIF: SPARC is produced by benign and malignant compartments of
bladder carcinomas where it functions to suppress bladder
carcinogenesis, progression, and metastasis.
REFERENCE 2 (bases 1 to 3604)
AUTHORS Oh,D.J., Kang,M.H., Ooi,Y.H., Choi,K.R., Sage,E.H. and Rhee,D.J.
TITLE Overexpression of SPARC in human trabecular meshwork increases
intraocular pressure and alters extracellular matrix
JOURNAL Invest. Ophthalmol. Vis. Sci. 54 (5), 3309-3319 (2013)
PUBMED 23599341
REMARK GeneRIF: SPARC overexpression increases IOP in perfused cadaveric
human anterior segments resulting from a qualitative change the
juxtacanalicular-extracellular matrix.
Publication Status: Online-Only
REFERENCE 3 (bases 1 to 3604)
AUTHORS Giallongo,C., La Cava,P., Tibullo,D., Barbagallo,I., Parrinello,N.,
Cupri,A., Stagno,F., Consoli,C., Chiarenza,A., Palumbo,G.A. and Di
Raimondo,F.
TITLE SPARC expression in CML is associated to imatinib treatment and to
inhibition of leukemia cell proliferation
JOURNAL BMC Cancer 13, 60 (2013)
PUBMED 23383963
REMARK GeneRIF: Low endogenous SPARC expression is a constant feature of
BCR/ABL positive cells and that imatinib treatment induces SPARC
overproduction.
Publication Status: Online-Only
REFERENCE 4 (bases 1 to 3604)
AUTHORS Zhu,X.C., Dong,Q.Z., Zhang,X.F., Deng,B., Jia,H.L., Ye,Q.H.,
Qin,L.X. and Wu,X.Z.
TITLE microRNA-29a suppresses cell proliferation by targeting SPARC in
hepatocellular carcinoma
JOURNAL Int. J. Mol. Med. 30 (6), 1321-1326 (2012)
PUBMED 23023935
REMARK GeneRIF: Expression of miR-29a is important in the regulation of
the SPARC gene expression and hepatocellular carcinoma growth.
REFERENCE 5 (bases 1 to 3604)
AUTHORS Chen,J., Shi,D., Liu,X., Fang,S., Zhang,J. and Zhao,Y.
TITLE Targeting SPARC by lentivirus-mediated RNA interference inhibits
cervical cancer cell growth and metastasis
JOURNAL BMC Cancer 12, 464 (2012)
PUBMED 23050783
REMARK GeneRIF: SPARC is related to the invasive phenotype of cervical
cancer cells. Knockdown of SPARC significantly suppresses cervical
cancer cell proliferation, induces cell apoptosis and inhibits cell
invasion and metastasis.
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 3604)
AUTHORS Breton-Gorius,J., Clezardin,P., Guichard,J., Debili,N., Malaval,L.,
Vainchenker,W., Cramer,E.M. and Delmas,P.D.
TITLE Localization of platelet osteonectin at the internal face of the
alpha-granule membranes in platelets and megakaryocytes
JOURNAL Blood 79 (4), 936-941 (1992)
PUBMED 1737102
REFERENCE 7 (bases 1 to 3604)
AUTHORS Raines,E.W., Lane,T.F., Iruela-Arispe,M.L., Ross,R. and Sage,E.H.
TITLE The extracellular glycoprotein SPARC interacts with
platelet-derived growth factor (PDGF)-AB and -BB and inhibits the
binding of PDGF to its receptors
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 89 (4), 1281-1285 (1992)
PUBMED 1311092
REFERENCE 8 (bases 1 to 3604)
AUTHORS Mundlos,S., Schwahn,B., Reichert,T. and Zabel,B.
TITLE Distribution of osteonectin mRNA and protein during human embryonic
and fetal development
JOURNAL J. Histochem. Cytochem. 40 (2), 283-291 (1992)
PUBMED 1552170
REFERENCE 9 (bases 1 to 3604)
AUTHORS Kelm,R.J. Jr. and Mann,K.G.
TITLE Human platelet osteonectin: release, surface expression, and
partial characterization
JOURNAL Blood 75 (5), 1105-1113 (1990)
PUBMED 2306517
REFERENCE 10 (bases 1 to 3604)
AUTHORS Young,M.F., Day,A.A., Dominquez,P., McQuillan,C.I., Fisher,L.W. and
Termine,J.D.
TITLE Structure and expression of osteonectin mRNA in human tissue
JOURNAL Connect. Tissue Res. 24 (1), 17-28 (1990)
PUBMED 2338025
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
BI602719.1, BC072457.1 and BQ018477.1.
On Dec 24, 2011 this sequence version replaced gi:48675809.
Summary: This gene encodes a cysteine-rich acidic matrix-associated
protein. The encoded protein is required for the collagen in bone
to become calcified but is also involved in extracellular matrix
synthesis and promotion of changes to cell shape. The gene product
has been associated with tumor suppression but has also been
correlated with metastasis based on changes to cell shape which can
promote tumor cell invasion. [provided by RefSeq, Dec 2011].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC072457.1, J03040.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025088 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-98 BI602719.1 4-101
99-3239 BC072457.1 1-3141
3240-3604 BQ018477.1 1-365 c
FEATURES Location/Qualifiers
source 1..3604
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="5"
/map="5q31.3-q32"
gene 1..3604
/gene="SPARC"
/gene_synonym="ON"
/note="secreted protein, acidic, cysteine-rich
(osteonectin)"
/db_xref="GeneID:6678"
/db_xref="HGNC:11219"
/db_xref="HPRD:01631"
/db_xref="MIM:182120"
exon 1..190
/gene="SPARC"
/gene_synonym="ON"
/inference="alignment:Splign:1.39.8"
misc_feature 111..113
/gene="SPARC"
/gene_synonym="ON"
/note="upstream in-frame stop codon"
STS 191..348
/gene="SPARC"
/gene_synonym="ON"
/standard_name="RH47515"
/db_xref="UniSTS:89827"
exon 191..260
/gene="SPARC"
/gene_synonym="ON"
/inference="alignment:Splign:1.39.8"
CDS 204..1115
/gene="SPARC"
/gene_synonym="ON"
/note="osteonectin; cysteine-rich protein; BM-40;
basement-membrane protein 40; secreted protein acidic and
rich in cysteine"
/codon_start=1
/product="SPARC precursor"
/protein_id="NP_003109.1"
/db_xref="GI:4507171"
/db_xref="CCDS:CCDS4318.1"
/db_xref="GeneID:6678"
/db_xref="HGNC:11219"
/db_xref="HPRD:01631"
/db_xref="MIM:182120"
/translation="
MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
"
sig_peptide 204..254
/gene="SPARC"
/gene_synonym="ON"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
mat_peptide 255..1112
/gene="SPARC"
/gene_synonym="ON"
/product="SPARC"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P09486.1)"
misc_feature 261..263
/gene="SPARC"
/gene_synonym="ON"
/experiment="experimental evidence, no additional details
recorded"
/note="proteolytic cleavage site; modified site"
/db_xref="HPRD:03064"
misc_feature 414..659
/gene="SPARC"
/gene_synonym="ON"
/note="Follistatin-like SPARC (secreted protein, acidic,
and rich in cysteines) domain; SPARC/BM-40/osteonectin is
a multifunctional glycoprotein which modulates cellular
interaction with the extracellular matrix by its binding
to structural matrix proteins...; Region: FSL_SPARC;
cd01328"
/db_xref="CDD:29000"
misc_feature order(417..419,450..452)
/gene="SPARC"
/gene_synonym="ON"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
misc_feature order(432..434,480..482)
/gene="SPARC"
/gene_synonym="ON"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
misc_feature 465..467
/gene="SPARC"
/gene_synonym="ON"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
misc_feature order(486..488,591..593)
/gene="SPARC"
/gene_synonym="ON"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
misc_feature order(504..506,570..572)
/gene="SPARC"
/gene_synonym="ON"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
misc_feature order(537..539,648..650)
/gene="SPARC"
/gene_synonym="ON"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
misc_feature 549..551
/gene="SPARC"
/gene_synonym="ON"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
misc_feature 549..551
/gene="SPARC"
/gene_synonym="ON"
/note="N-glycosylation site [posttranslational
modification]; other site"
/db_xref="CDD:29000"
misc_feature 660..1070
/gene="SPARC"
/gene_synonym="ON"
/note="Secreted protein acidic and rich in cysteine Ca
binding region; Region: SPARC_Ca_bdg; pfam10591"
/db_xref="CDD:204523"
misc_feature 663..1106
/gene="SPARC"
/gene_synonym="ON"
/note="SPARC_EC; extracellular Ca2+ binding domain
(containing 2 EF-hand motifs) of SPARC and related
proteins (QR1, SC1/hevin, testican and tsc-36/FRP). SPARC
(BM-40) is a multifunctional glycoprotein, a matricellular
protein, that functions to regulate...; Region: SPARC_EC;
cd00252"
/db_xref="CDD:29326"
misc_feature order(666..668,996..998)
/gene="SPARC"
/gene_synonym="ON"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
misc_feature order(699..704,708..716,720..728)
/gene="SPARC"
/gene_synonym="ON"
/note="collagen binding site [polypeptide binding]; other
site"
/db_xref="CDD:29326"
misc_feature 786..788
/gene="SPARC"
/gene_synonym="ON"
/experiment="experimental evidence, no additional details
recorded"
/note="proteolytic cleavage site; modified site"
/db_xref="HPRD:03064"
misc_feature order(918..926,930..956,1023..1058)
/gene="SPARC"
/gene_synonym="ON"
/note="EF-hand Ca2+ binding loops [ion binding]; other
site"
/db_xref="CDD:29326"
misc_feature order(924..926,948..953,993..995)
/gene="SPARC"
/gene_synonym="ON"
/note="FS-domain interface [polypeptide binding]; other
site"
/db_xref="CDD:29326"
misc_feature 990..992
/gene="SPARC"
/gene_synonym="ON"
/note="putative K+ binding site [ion binding]; other site"
/db_xref="CDD:29326"
misc_feature order(1020..1022,1068..1070)
/gene="SPARC"
/gene_synonym="ON"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
exon 261..323
/gene="SPARC"
/gene_synonym="ON"
/inference="alignment:Splign:1.39.8"
variation 273
/gene="SPARC"
/gene_synonym="ON"
/replace="a"
/replace="c"
/db_xref="dbSNP:11542496"
variation 277
/gene="SPARC"
/gene_synonym="ON"
/replace="a"
/replace="c"
/db_xref="dbSNP:11542497"
variation 298
/gene="SPARC"
/gene_synonym="ON"
/replace="a"
/replace="g"
/db_xref="dbSNP:11542498"
exon 324..411
/gene="SPARC"
/gene_synonym="ON"
/inference="alignment:Splign:1.39.8"
STS 329..471
/gene="SPARC"
/gene_synonym="ON"
/standard_name="RH71413"
/db_xref="UniSTS:75456"
exon 412..533
/gene="SPARC"
/gene_synonym="ON"
/inference="alignment:Splign:1.39.8"
exon 534..654
/gene="SPARC"
/gene_synonym="ON"
/inference="alignment:Splign:1.39.8"
variation 586
/gene="SPARC"
/gene_synonym="ON"
/replace="c"
/replace="t"
/db_xref="dbSNP:11542492"
variation 605
/gene="SPARC"
/gene_synonym="ON"
/replace="c"
/replace="t"
/db_xref="dbSNP:11542495"
exon 655..788
/gene="SPARC"
/gene_synonym="ON"
/inference="alignment:Splign:1.39.8"
variation 669
/gene="SPARC"
/gene_synonym="ON"
/replace="c"
/replace="g"
/db_xref="dbSNP:11542494"
variation 673
/gene="SPARC"
/gene_synonym="ON"
/replace="a"
/replace="g"
/db_xref="dbSNP:11542493"
variation 705
/gene="SPARC"
/gene_synonym="ON"
/replace="c"
/replace="g"
/db_xref="dbSNP:1053296"
variation 708
/gene="SPARC"
/gene_synonym="ON"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:707157"
exon 789..937
/gene="SPARC"
/gene_synonym="ON"
/inference="alignment:Splign:1.39.8"
exon 938..1086
/gene="SPARC"
/gene_synonym="ON"
/inference="alignment:Splign:1.39.8"
variation 1013
/gene="SPARC"
/gene_synonym="ON"
/replace="c"
/replace="t"
/db_xref="dbSNP:34827878"
exon 1087..3590
/gene="SPARC"
/gene_synonym="ON"
/inference="alignment:Splign:1.39.8"
variation 1144
/gene="SPARC"
/gene_synonym="ON"
/replace="c"
/replace="g"
/db_xref="dbSNP:1053411"
STS 1183..1346
/gene="SPARC"
/gene_synonym="ON"
/standard_name="D5S444E"
/db_xref="UniSTS:6399"
variation 1263
/gene="SPARC"
/gene_synonym="ON"
/replace="a"
/replace="t"
/db_xref="dbSNP:1060151"
STS 1316..1380
/gene="SPARC"
/gene_synonym="ON"
/standard_name="234"
/db_xref="UniSTS:34189"
STS 1346..1600
/gene="SPARC"
/gene_synonym="ON"
/standard_name="GDB:294200"
/db_xref="UniSTS:156392"
STS 1447..2284
/gene="SPARC"
/gene_synonym="ON"
/standard_name="SPARC_1369"
/db_xref="UniSTS:462567"
variation 1559
/gene="SPARC"
/gene_synonym="ON"
/replace="a"
/replace="g"
/db_xref="dbSNP:11542490"
variation 1597
/gene="SPARC"
/gene_synonym="ON"
/replace="g"
/replace="t"
/db_xref="dbSNP:1053660"
variation 1655
/gene="SPARC"
/gene_synonym="ON"
/replace="g"
/replace="t"
/db_xref="dbSNP:3194455"
variation 1697
/gene="SPARC"
/gene_synonym="ON"
/replace="c"
/replace="g"
/db_xref="dbSNP:1054204"
STS 1795..1922
/gene="SPARC"
/gene_synonym="ON"
/standard_name="STS-J03040"
/db_xref="UniSTS:3559"
variation 1801
/gene="SPARC"
/gene_synonym="ON"
/replace="g"
/replace="t"
/db_xref="dbSNP:1055210"
variation 1870
/gene="SPARC"
/gene_synonym="ON"
/replace="c"
/replace="t"
/db_xref="dbSNP:1804455"
STS 2003..2144
/gene="SPARC"
/gene_synonym="ON"
/standard_name="RH68620"
/db_xref="UniSTS:52073"
variation 2008
/gene="SPARC"
/gene_synonym="ON"
/replace="c"
/replace="t"
/db_xref="dbSNP:1804456"
STS 2018..2228
/gene="SPARC"
/gene_synonym="ON"
/standard_name="RH41219"
/db_xref="UniSTS:92802"
variation 2191
/gene="SPARC"
/gene_synonym="ON"
/replace="a"
/replace="c"
/db_xref="dbSNP:1064799"
variation 2218
/gene="SPARC"
/gene_synonym="ON"
/replace="c"
/replace="t"
/db_xref="dbSNP:1059829"
variation 2315
/gene="SPARC"
/gene_synonym="ON"
/replace="a"
/replace="g"
/db_xref="dbSNP:3210714"
STS 2949..3200
/gene="SPARC"
/gene_synonym="ON"
/standard_name="A007I34"
/db_xref="UniSTS:8192"
STS 3098..3187
/gene="SPARC"
/gene_synonym="ON"
/standard_name="D5S2386"
/db_xref="UniSTS:32201"
ORIGIN
gggagaaggaggaggccgggggaaggaggagacaggaggaggagggaccacggggtggaggggagatagacccagcccagagctctgagtggtttcctgttgcctgtctctaaacccctccacattcccgcggtccttcagactgcccggagagcgcgctctgcctgccgcctgcctgcctgccactgagggttcccagcaccatgagggcctggatcttctttctcctttgcctggccgggagggccttggcagcccctcagcaagaagccctgcctgatgagacagaggtggtggaagaaactgtggcagaggtgactgaggtatctgtgggagctaatcctgtccaggtggaagtaggagaatttgatgatggtgcagaggaaaccgaagaggaggtggtggcggaaaatccctgccagaaccaccactgcaaacacggcaaggtgtgcgagctggatgagaacaacacccccatgtgcgtgtgccaggaccccaccagctgcccagcccccattggcgagtttgagaaggtgtgcagcaatgacaacaagaccttcgactcttcctgccacttctttgccacaaagtgcaccctggagggcaccaagaagggccacaagctccacctggactacatcgggccttgcaaatacatccccccttgcctggactctgagctgaccgaattccccctgcgcatgcgggactggctcaagaacgtcctggtcaccctgtatgagagggatgaggacaacaaccttctgactgagaagcagaagctgcgggtgaagaagatccatgagaatgagaagcgcctggaggcaggagaccaccccgtggagctgctggcccgggacttcgagaagaactataacatgtacatcttccctgtacactggcagttcggccagctggaccagcaccccattgacgggtacctctcccacaccgagctggctccactgcgtgctcccctcatccccatggagcattgcaccacccgctttttcgagacctgtgacctggacaatgacaagtacatcgccctggatgagtgggccggctgcttcggcatcaagcagaaggatatcgacaaggatcttgtgatctaaatccactccttccacagtaccggattctctctttaaccctccccttcgtgtttcccccaatgtttaaaatgtttggatggtttgttgttctgcctggagacaaggtgctaacatagatttaagtgaatacattaacggtgctaaaaatgaaaattctaacccaagacatgacattcttagctgtaacttaactattaaggccttttccacacgcattaatagtcccatttttctcttgccatttgtagctttgcccattgtcttattggcacatgggtggacacggatctgctgggctctgccttaaacacacattgcagcttcaacttttctctttagtgttctgtttgaaactaatacttaccgagtcagactttgtgttcatttcatttcagggtcttggctgcctgtgggcttccccaggtggcctggaggtgggcaaagggaagtaacagacacacgatgttgtcaaggatggttttgggactagaggctcagtggtgggagagatccctgcagaacccaccaaccagaacgtggtttgcctgaggctgtaactgagagaaagattctggggctgtgttatgaaaatatagacattctcacataagcccagttcatcaccatttcctcctttacctttcagtgcagtttcttttcacattaggctgttggttcaaacttttgggagcacggactgtcagttctctgggaagtggtcagcgcatcctgcagggcttctcctcctctgtcttttggagaaccagggctcttctcaggggctctagggactgccaggctgtttcagccaggaaggccaaaatcaagagtgagatgtagaaagttgtaaaatagaaaaagtggagttggtgaatcggttgttctttcctcacatttggatgattgtcataaggtttttagcatgttcctccttttcttcaccctccccttttttcttctattaatcaagagaaacttcaaagttaatgggatggtcggatctcacaggctgagaactcgttcacctccaagcatttcatgaaaaagctgcttcttattaatcatacaaactctcaccatgatgtgaagagtttcacaaatccttcaaaataaaaagtaatgacttagaaactgccttcctgggtgatttgcatgtgtcttagtcttagtcaccttattatcctgacacaaaaacacatgagcatacatgtctacacatgactacacaaatgcaaacctttgcaaacacattatgcttttgcacacacacacctgtacacacacaccggcatgtttatacacagggagtgtatggttcctgtaagcactaagttagctgttttcatttaatgacctgtggtttaacccttttgatcactaccaccattatcagcaccagactgagcagctatatccttttattaatcatggtcattcattcattcattcattcacaaaatatttatgatgtatttactctgcaccaggtcccatgccaagcactggggacacagttatggcaaagtagacaaagcatttgttcatttggagcttagagtccaggaggaatacattagataatgacacaatcaaatataaattgcaagatgtcacaggtgtgatgaagggagagtaggagagaccatgagtatgtgtaacaggaggacacagcattattctagtgctgtactgttccgtacggcagccactacccacatgtaactttttaagatttaaatttaaattagttaacattcaaaacgcagctccccaatcacactagcaacatttcaagtgcttgagagccatgcatgattagtggttaccctattgaataggtcagaagtagaatcttttcatcatcacagaaagttctattggacagtgctcttctagatcatcataagactacagagcacttttcaaagctcatgcatgttcatcatgttagtgtcgtattttgagctggggttttgagactccccttagagatagagaaacagacccaagaaatgtgctcaattgcaatgggccacatacctagatctccagatgtcatttcccctctcttattttaagttatgttaagattactaaaacaataaaagctcctaaaaaatcaaactgtattctggtgttctcttctacacagtgggagggcgagcagtaggagagattggcccatttggtgctggccatttgaggaatgcaagcccagcactagtctcataatctctaggaatctgtagagagaggaattgaagtaaatttcagcattggctcattcagtcattcggcgacattcatcaggtacctgcaatgtgttaggggatcttatgagtaggcagcgtgcgtgatccttgctcccctggagctttctaacattctagcaggcagaccacacataaatttgcaatactgtttctgataaaaacgtgctgtaaaggaaataaagcagagaactatcatggaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:6678 -> Molecular function: GO:0005509 [calcium ion binding] evidence: IEA
GeneID:6678 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:6678 -> Molecular function: GO:0005518 [collagen binding] evidence: TAS
GeneID:6678 -> Molecular function: GO:0050840 [extracellular matrix binding] evidence: IEA
GeneID:6678 -> Biological process: GO:0001503 [ossification] evidence: IEA
GeneID:6678 -> Biological process: GO:0002576 [platelet degranulation] evidence: TAS
GeneID:6678 -> Biological process: GO:0007165 [signal transduction] evidence: IEA
GeneID:6678 -> Biological process: GO:0007507 [heart development] evidence: IEA
GeneID:6678 -> Biological process: GO:0007596 [blood coagulation] evidence: TAS
GeneID:6678 -> Biological process: GO:0009629 [response to gravity] evidence: IEA
GeneID:6678 -> Biological process: GO:0010288 [response to lead ion] evidence: IEA
GeneID:6678 -> Biological process: GO:0030168 [platelet activation] evidence: TAS
GeneID:6678 -> Biological process: GO:0030198 [extracellular matrix organization] evidence: TAS
GeneID:6678 -> Biological process: GO:0030324 [lung development] evidence: IEA
GeneID:6678 -> Biological process: GO:0032496 [response to lipopolysaccharide] evidence: IEA
GeneID:6678 -> Biological process: GO:0033591 [response to L-ascorbic acid] evidence: IEA
GeneID:6678 -> Biological process: GO:0034097 [response to cytokine stimulus] evidence: IEA
GeneID:6678 -> Biological process: GO:0042127 [regulation of cell proliferation] evidence: IEA
GeneID:6678 -> Biological process: GO:0043434 [response to peptide hormone stimulus] evidence: IEA
GeneID:6678 -> Biological process: GO:0045471 [response to ethanol] evidence: IEA
GeneID:6678 -> Biological process: GO:0046686 [response to cadmium ion] evidence: IEA
GeneID:6678 -> Biological process: GO:0048839 [inner ear development] evidence: IEA
GeneID:6678 -> Biological process: GO:0051384 [response to glucocorticoid stimulus] evidence: IEA
GeneID:6678 -> Biological process: GO:0051591 [response to cAMP] evidence: IEA
GeneID:6678 -> Biological process: GO:0051592 [response to calcium ion] evidence: IEA
GeneID:6678 -> Biological process: GO:0060348 [bone development] evidence: IEA
GeneID:6678 -> Biological process: GO:0071363 [cellular response to growth factor stimulus] evidence: IEA
GeneID:6678 -> Cellular component: GO:0005576 [extracellular region] evidence: NAS
GeneID:6678 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS
GeneID:6678 -> Cellular component: GO:0005578 [proteinaceous extracellular matrix] evidence: TAS
GeneID:6678 -> Cellular component: GO:0005604 [basement membrane] evidence: IEA
GeneID:6678 -> Cellular component: GO:0005615 [extracellular space] evidence: IEA
GeneID:6678 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
GeneID:6678 -> Cellular component: GO:0031093 [platelet alpha granule lumen] evidence: TAS
GeneID:6678 -> Cellular component: GO:0071682 [endocytic vesicle lumen] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.