Home |
Help |
Advanced search
2025-05-09 20:13:46, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001204182 1750 bp mRNA linear PRI 16-JUN-2013
DEFINITION Homo sapiens NIMA-related kinase 2 (NEK2), transcript variant 3,
mRNA.
ACCESSION NM_001204182
VERSION NM_001204182.1 GI:323510687
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1750)
AUTHORS Sedgwick,G.G., Hayward,D.G., Di Fiore,B., Pardo,M., Yu,L., Pines,J.
and Nilsson,J.
TITLE Mechanisms controlling the temporal degradation of Nek2A and Kif18A
by the APC/C-Cdc20 complex
JOURNAL EMBO J. 32 (2), 303-314 (2013)
PUBMED 23288039
REMARK GeneRIF: Nek2A binds with high affinity to apo-APC/C and is
degraded by the pool of Cdc20 that avoids inhibition by the spindle
assembly checkpoint.
REFERENCE 2 (bases 1 to 1750)
AUTHORS Wang,H., Xie,Y.T., Han,J.Y., Ruan,Y., Song,A.P., Zheng,L.Y.,
Zhang,W.Z., Sajdik,C., Li,Y., Tian,X.X. and Fang,W.G.
TITLE Genetic polymorphisms in centrobin and Nek2 are associated with
breast cancer susceptibility in a Chinese Han population
JOURNAL Breast Cancer Res. Treat. 136 (1), 241-251 (2012)
PUBMED 23001753
REMARK GeneRIF: Our results indicate that genetic polymorphisms of
centrobin and Nek2 are related to breast cancer susceptibility in
Chinese Han women.
REFERENCE 3 (bases 1 to 1750)
AUTHORS Liu,Z., Wang,Y., Wang,S., Zhang,J., Zhang,F. and Niu,Y.
TITLE Nek2C functions as a tumor promoter in human breast tumorigenesis
JOURNAL Int. J. Mol. Med. 30 (4), 775-782 (2012)
PUBMED 22824957
REMARK GeneRIF: Nek2 C downregulation, using RNA interference, decreased
the survival, invasion and migration of MCF10DCIS.com and MCF10CA1a
cells as well as in human primary breast cancer tissue.
REFERENCE 4 (bases 1 to 1750)
AUTHORS Nischalke,H.D., Schmitz,V., Luda,C., Aldenhoff,K., Berger,C.,
Feldmann,G., Sauerbruch,T., Spengler,U. and Nattermann,J.
TITLE Detection of IGF2BP3, HOXB7, and NEK2 mRNA expression in brush
cytology specimens as a new diagnostic tool in patients with
biliary strictures
JOURNAL PLoS ONE 7 (8), E42141 (2012)
PUBMED 22879911
REMARK GeneRIF: Measuring IGF2BP3, HOXB7 and NEK2 mRNA levels by RT-PCR in
addition to cytology has the potential to improve detection of
malignant biliary disorders from brush cytology specimens.
REFERENCE 5 (bases 1 to 1750)
AUTHORS Noguchi,K., Fukazawa,H., Murakami,Y. and Uehara,Y.
TITLE Nucleolar Nek11 is a novel target of Nek2A in G1/S-arrested cells
JOURNAL J. Biol. Chem. 279 (31), 32716-32727 (2004)
PUBMED 15161910
REMARK GeneRIF: Nucleolar Nek11 is a novel target of Nek2A in
G1/S-arrested cells
REFERENCE 6 (bases 1 to 1750)
AUTHORS Hames,R.S. and Fry,A.M.
TITLE Alternative splice variants of the human centrosome kinase Nek2
exhibit distinct patterns of expression in mitosis
JOURNAL Biochem. J. 361 (PT 1), 77-85 (2002)
PUBMED 11742531
REFERENCE 7 (bases 1 to 1750)
AUTHORS Fry,A.M., Meraldi,P. and Nigg,E.A.
TITLE A centrosomal function for the human Nek2 protein kinase, a member
of the NIMA family of cell cycle regulators
JOURNAL EMBO J. 17 (2), 470-481 (1998)
PUBMED 9430639
REFERENCE 8 (bases 1 to 1750)
AUTHORS Golsteyn,R.M., Mundt,K.E., Fry,A.M. and Nigg,E.A.
TITLE Cell cycle regulation of the activity and subcellular localization
of Plk1, a human protein kinase implicated in mitotic spindle
function
JOURNAL J. Cell Biol. 129 (6), 1617-1628 (1995)
PUBMED 7790358
REFERENCE 9 (bases 1 to 1750)
AUTHORS Schultz,S.J., Fry,A.M., Sutterlin,C., Ried,T. and Nigg,E.A.
TITLE Cell cycle-dependent expression of Nek2, a novel human protein
kinase related to the NIMA mitotic regulator of Aspergillus
nidulans
JOURNAL Cell Growth Differ. 5 (6), 625-635 (1994)
PUBMED 7522034
REFERENCE 10 (bases 1 to 1750)
AUTHORS Schultz,S.J. and Nigg,E.A.
TITLE Identification of 21 novel human protein kinases, including 3
members of a family related to the cell cycle regulator nimA of
Aspergillus nidulans
JOURNAL Cell Growth Differ. 4 (10), 821-830 (1993)
PUBMED 8274451
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DC407297.1, BT019729.1 and
AK225522.1.
This sequence is a reference standard in the RefSeqGene project.
Summary: This gene encodes a serine/threonine-protein kinase that
is involved in mitotic regulation. This protein is localized to the
centrosome, and undetectable during G1 phase, but accumulates
progressively throughout the S phase, reaching maximal levels in
late G2 phase. Alternatively spliced transcript variants encoding
different isoforms with distinct C-termini have been noted for this
gene. [provided by RefSeq, Feb 2011].
Transcript Variant: This variant (3) contains an alternate 3'
terminal exon compared to variant 1. This results in a frame-shift
and a shorter isoform (3) with a distinct C-terminus compared to
isoform 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AK225522.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025081, ERS025083 [ECO:0000350]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-577 DC407297.1 1-577
578-1262 BT019729.1 427-1111
1263-1750 AK225522.1 1224-1711
FEATURES Location/Qualifiers
source 1..1750
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1q32.2-q41"
gene 1..1750
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/note="NIMA-related kinase 2"
/db_xref="GeneID:4751"
/db_xref="HGNC:7745"
/db_xref="MIM:604043"
exon 1..247
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/inference="alignment:Splign:1.39.8"
CDS 152..1318
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/EC_number="2.7.11.1"
/note="isoform 3 is encoded by transcript variant 3;
serine/threonine-protein kinase Nek2; nimA-like protein
kinase 1; nimA-related protein kinase 2; NIMA (never in
mitosis gene a)-related kinase 2"
/codon_start=1
/product="serine/threonine-protein kinase Nek2 isoform 3"
/protein_id="NP_001191111.1"
/db_xref="GI:323510688"
/db_xref="GeneID:4751"
/db_xref="HGNC:7745"
/db_xref="MIM:604043"
/translation="
MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPEKSQDSSPVLSELKLKEIQLQERERALKAREERLEQKEQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNPESHFVAQAGMQWCDHSSM
"
misc_feature 170..964
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/note="Catalytic domain of the Protein Serine/Threonine
Kinase, Never In Mitosis gene A-related kinase 2; Region:
STKc_Nek2; cd08217"
/db_xref="CDD:173757"
misc_feature 173..964
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/note="Serine/Threonine protein kinases, catalytic domain;
Region: S_TKc; smart00220"
/db_xref="CDD:197582"
misc_feature order(191..205,215..217,254..256,260..262,353..355,
407..418,428..430,434..436,572..574,578..580,584..589,
593..595,626..628,635..637,641..643,683..694)
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/note="active site"
/db_xref="CDD:173757"
misc_feature order(191..196,200..205,215..217,254..256,260..262,
353..355,410..418,428..430,587..589,593..595,641..643)
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:173757"
misc_feature order(203..205,428..430,434..436,572..574,578..580,
584..586,635..637,683..694)
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/note="substrate binding site [chemical binding]; other
site"
/db_xref="CDD:173757"
misc_feature order(623..661,668..694)
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/note="activation loop (A-loop); other site"
/db_xref="CDD:173757"
misc_feature 674..676
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine, by autocatalysis; propagated from
UniProtKB/Swiss-Prot (P51955.1); phosphorylation site"
misc_feature 686..688
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine, by autocatalysis; propagated from
UniProtKB/Swiss-Prot (P51955.1); phosphorylation site"
misc_feature 872..874
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by autocatalysis; propagated from
UniProtKB/Swiss-Prot (P51955.1); phosphorylation site"
misc_feature 1037..1039
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P51955.1); phosphorylation site"
misc_feature 1067..1153
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P51955.1);
Region: Leucine-zipper"
misc_feature 1148..1261
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P51955.1);
Region: Required for microtubule binding and for
localization to the centrosomes"
misc_feature 1217..1219
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by STK3/MST2; propagated from
UniProtKB/Swiss-Prot (P51955.1); phosphorylation site"
misc_feature 1244..1246
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by STK3/MST2; propagated from
UniProtKB/Swiss-Prot (P51955.1); phosphorylation site"
misc_feature 1265..>1312
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/note="Putative binding domain; Region: GVQW; pfam13900"
/db_xref="CDD:206071"
exon 248..465
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/inference="alignment:Splign:1.39.8"
exon 466..706
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/inference="alignment:Splign:1.39.8"
variation 577
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/replace="g"
/replace="t"
/db_xref="dbSNP:1056729"
variation 655
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/replace="c"
/replace="t"
/db_xref="dbSNP:701929"
exon 707..789
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/inference="alignment:Splign:1.39.8"
exon 790..916
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/inference="alignment:Splign:1.39.8"
exon 917..1136
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/inference="alignment:Splign:1.39.8"
exon 1137..1262
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/inference="alignment:Splign:1.39.8"
variation 1212
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/replace="a"
/replace="g"
/db_xref="dbSNP:2230489"
exon 1263..1719
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/inference="alignment:Splign:1.39.8"
STS 1264..1412
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
/standard_name="SHGC-67307"
/db_xref="UniSTS:89991"
polyA_signal 1692..1697
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
polyA_site 1719
/gene="NEK2"
/gene_synonym="HsPK21; NEK2A; NLK1"
ORIGIN
gcgacggttaaacggggcccaaggcaggggtggcgggtcagtgctgctcgggggcttctccatccaggtccctggagttcctggtccctggagctccgcacttggcggcgcaacctgcgtgaggcagcgcgactctggcgactggccggccatgccttcccgggctgaggactatgaagtgttgtacaccattggcacaggctcctacggccgctgccagaagatccggaggaagagtgatggcaagatattagtttggaaagaacttgactatggctccatgacagaagctgagaaacagatgcttgtttctgaagtgaatttgcttcgtgaactgaaacatccaaacatcgttcgttactatgatcggattattgaccggaccaatacaacactgtacattgtaatggaatattgtgaaggaggggatctggctagtgtaattacaaagggaaccaaggaaaggcaatacttagatgaagagtttgttcttcgagtgatgactcagttgactctggccctgaaggaatgccacagacgaagtgatggtggtcataccgtattgcatcgggatctgaaaccagccaatgttttcctggatggcaagcaaaacgtcaagcttggagactttgggctagctagaatattaaaccatgacacgagttttgcaaaaacatttgttggcacaccttattacatgtctcctgaacaaatgaatcgcatgtcctacaatgagaaatcagatatctggtcattgggctgcttgctgtatgagttatgtgcattaatgcctccatttacagcttttagccagaaagaactcgctgggaaaatcagagaaggcaaattcaggcgaattccataccgttactctgatgaattgaatgaaattattacgaggatgttaaacttaaaggattaccatcgaccttctgttgaagaaattcttgagaaccctttaatagcagatttggttgcagacgagcaaagaagaaatcttgagagaagagggcgacaattaggagagccagaaaaatcgcaggattccagccctgtattgagtgagctgaaactgaaggaaattcagttacaggagcgagagcgagctctcaaagcaagagaagaaagattggagcagaaagaacaggagctttgtgttcgtgagagactagcagaggacaaactggctagagcagaaaatctgttgaagaactacagcttgctaaaggaacggaagttcctgtctctggcaagtaatccagagtctcactttgttgcccaggctggaatgcagtggtgtgatcacagctcaatgtagccttggcctcgtaggctcaagtaatcctcccacttcagcctcctgtgatggagtctcactgttttgcccaggatggtcttgaactcatgggctcaagcaatcctcccaccttggctgggattacaggtatgagccattgcgcccagcccctttatgacctatttctttatgaatatggcttgtctgttcattactgatataattatgcaactttcattagtatatatgaatgtttatgcttgcacaaaaatgtatgttattattgcctattttattgcataaagtgacctatgaagtgttctgtgttttcatatgtttctcaaataaattccctttaaaaatgtaaatacatgtaaatgtaaaaaaaaaagtaaataaatatcttttaaagaatttttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:4751 -> Molecular function: GO:0004672 [protein kinase activity] evidence: IDA
GeneID:4751 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: TAS
GeneID:4751 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:4751 -> Molecular function: GO:0005524 [ATP binding] evidence: IEA
GeneID:4751 -> Molecular function: GO:0019903 [protein phosphatase binding] evidence: IPI
GeneID:4751 -> Molecular function: GO:0046872 [metal ion binding] evidence: IEA
GeneID:4751 -> Biological process: GO:0000070 [mitotic sister chromatid segregation] evidence: IEA
GeneID:4751 -> Biological process: GO:0000086 [G2/M transition of mitotic cell cycle] evidence: TAS
GeneID:4751 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:4751 -> Biological process: GO:0001824 [blastocyst development] evidence: IEA
GeneID:4751 -> Biological process: GO:0006468 [protein phosphorylation] evidence: IDA
GeneID:4751 -> Biological process: GO:0007059 [chromosome segregation] evidence: IDA
GeneID:4751 -> Biological process: GO:0007067 [mitosis] evidence: TAS
GeneID:4751 -> Biological process: GO:0007088 [regulation of mitosis] evidence: TAS
GeneID:4751 -> Biological process: GO:0007126 [meiosis] evidence: IEA
GeneID:4751 -> Biological process: GO:0043392 [negative regulation of DNA binding] evidence: IEA
GeneID:4751 -> Biological process: GO:0046602 [regulation of mitotic centrosome separation] evidence: TAS
GeneID:4751 -> Biological process: GO:0046777 [protein autophosphorylation] evidence: IDA
GeneID:4751 -> Biological process: GO:0046777 [protein autophosphorylation] evidence: IMP
GeneID:4751 -> Biological process: GO:0051225 [spindle assembly] evidence: TAS
GeneID:4751 -> Biological process: GO:0051299 [centrosome separation] evidence: IDA
GeneID:4751 -> Biological process: GO:0051301 [cell division] evidence: IEA
GeneID:4751 -> Biological process: GO:0051988 [regulation of attachment of spindle microtubules to kinetochore] evidence: IMP
GeneID:4751 -> Biological process: GO:0090307 [spindle assembly involved in mitosis] evidence: IEA
GeneID:4751 -> Cellular component: GO:0000776 [kinetochore] evidence: IDA
GeneID:4751 -> Cellular component: GO:0000777 [condensed chromosome kinetochore] evidence: IEA
GeneID:4751 -> Cellular component: GO:0000794 [condensed nuclear chromosome] evidence: IEA
GeneID:4751 -> Cellular component: GO:0000922 [spindle pole] evidence: IEA
GeneID:4751 -> Cellular component: GO:0005730 [nucleolus] evidence: IEA
GeneID:4751 -> Cellular component: GO:0005813 [centrosome] evidence: IDA
GeneID:4751 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:4751 -> Cellular component: GO:0005874 [microtubule] evidence: IEA
GeneID:4751 -> Cellular component: GO:0030496 [midbody] evidence: IEA
GeneID:4751 -> Cellular component: GO:0043234 [protein complex] evidence: IMP
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001191111 -> EC 2.7.11.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.