Home |
Help |
Advanced search
2025-05-09 20:18:05, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001170639 2315 bp mRNA linear PRI 15-APR-2013
DEFINITION Homo sapiens cyclin-dependent kinase 20 (CDK20), transcript variant
4, mRNA.
ACCESSION NM_001170639
VERSION NM_001170639.1 GI:282402174
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2315)
AUTHORS Mumert,M., Dubuc,A., Wu,X., Northcott,P.A., Chin,S.S., Pedone,C.A.,
Taylor,M.D. and Fults,D.W.
TITLE Functional genomics identifies drivers of medulloblastoma
dissemination
JOURNAL Cancer Res. 72 (19), 4944-4953 (2012)
PUBMED 22875024
REMARK GeneRIF: Data indicate that expression of ERAS, LHX1, and CCRK is
increased in aggressive subgroups of medulloblastomas.
REFERENCE 2 (bases 1 to 2315)
AUTHORS Feng,H., Cheng,A.S., Tsang,D.P., Li,M.S., Go,M.Y., Cheung,Y.S.,
Zhao,G.J., Ng,S.S., Lin,M.C., Yu,J., Lai,P.B., To,K.F. and
Sung,J.J.
TITLE Cell cycle-related kinase is a direct androgen receptor-regulated
gene that drives beta-catenin/T cell factor-dependent
hepatocarcinogenesis
JOURNAL J. Clin. Invest. 121 (8), 3159-3175 (2011)
PUBMED 21747169
REMARK GeneRIF: Cell cycle-related kinase is a direct androgen
receptor-regulated gene that drives beta-catenin/T cell
factor-dependent hepatocarcinogenesis
REFERENCE 3 (bases 1 to 2315)
AUTHORS An,X., Ng,S.S., Xie,D., Zeng,Y.X., Sze,J., Wang,J., Chen,Y.C.,
Chow,B.K., Lu,G., Poon,W.S., Kung,H.F., Wong,B.C. and Lin,M.C.
TITLE Functional characterisation of cell cycle-related kinase (CCRK) in
colorectal cancer carcinogenesis
JOURNAL Eur. J. Cancer 46 (9), 1752-1761 (2010)
PUBMED 20466538
REMARK GeneRIF: results suggest for the first time that CCRK is involved
in colorectal cancer carcinogenesis and G1/S cell cycle transition
by regulating Cdk2, cyclin E and Rb.
REFERENCE 4 (bases 1 to 2315)
AUTHORS Wu,G.Q., Xie,D., Yang,G.F., Liao,Y.J., Mai,S.J., Deng,H.X., Sze,J.,
Guan,X.Y., Zeng,Y.X., Lin,M.C. and Kung,H.F.
TITLE Cell cycle-related kinase supports ovarian carcinoma cell
proliferation via regulation of cyclin D1 and is a predictor of
outcome in patients with ovarian carcinoma
JOURNAL Int. J. Cancer 125 (11), 2631-2642 (2009)
PUBMED 19672860
REMARK GeneRIF: Overexpression of CCRK is associated with ovarian
carcinoma.
REFERENCE 5 (bases 1 to 2315)
AUTHORS Malumbres,M., Harlow,E., Hunt,T., Hunter,T., Lahti,J.M.,
Manning,G., Morgan,D.O., Tsai,L.H. and Wolgemuth,D.J.
TITLE Cyclin-dependent kinases: a family portrait
JOURNAL Nat. Cell Biol. 11 (11), 1275-1276 (2009)
PUBMED 19884882
REFERENCE 6 (bases 1 to 2315)
AUTHORS Qiu,H., Dai,H., Jain,K., Shah,R., Hong,C., Pain,J., Tian,B.,
Vatner,D.E., Vatner,S.F. and Depre,C.
TITLE Characterization of a novel cardiac isoform of the cell
cycle-related kinase that is regulated during heart failure
JOURNAL J. Biol. Chem. 283 (32), 22157-22165 (2008)
PUBMED 18508765
REFERENCE 7 (bases 1 to 2315)
AUTHORS Wohlbold,L., Larochelle,S., Liao,J.C., Livshits,G., Singer,J.,
Shokat,K.M. and Fisher,R.P.
TITLE The cyclin-dependent kinase (CDK) family member PNQALRE/CCRK
supports cell proliferation but has no intrinsic CDK-activating
kinase (CAK) activity
JOURNAL Cell Cycle 5 (5), 546-554 (2006)
PUBMED 16552187
REMARK GeneRIF: Depletion of PNQALRE by >80% due to RNA interference
(RNAi) impairs cell proliferation, but fails to arrest the cell
cycle at a discrete point.
REFERENCE 8 (bases 1 to 2315)
AUTHORS Liu,Y., Wu,C. and Galaktionov,K.
TITLE p42, a novel cyclin-dependent kinase-activating kinase in mammalian
cells
JOURNAL J. Biol. Chem. 279 (6), 4507-4514 (2004)
PUBMED 14597612
REMARK GeneRIF: identification of p42, a novel cyclin-dependent
kinase-activating kinase (CAK) activity in human cells; p42 is
essential for the phosphorylation of Thr-160 and activation of CDK2
and is indispensable for cell growth
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DB469301.1, CB992644.1,
AK075325.1, AY904367.1, BC002655.2, AL353572.13, AI479563.1 and
BM982394.1.
Summary: The protein encoded by this gene contains a kinase domain
most closely related to the cyclin-dependent protein kinases. The
encoded kinase may activate cyclin-dependent kinase 2 and is
involved in cell growth. Alternatively spliced transcript variants
encoding distinct isoforms have been reported. [provided by RefSeq,
Dec 2009].
Transcript Variant: This variant (4) uses an alternate in-frame
splice site in the 5' coding region, and an alternate splice site
in the 3' coding region, which results in a frameshift compared to
variant 1. This results in a shorter protein (isoform 4), compared
to isoform 1.
##Evidence-Data-START##
Transcript exon combination :: BC002655.2 [ECO:0000332]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-18 DB469301.1 1-18
19-409 CB992644.1 28-418
410-456 AK075325.1 202-248
457-457 AY904367.1 123-123
458-1914 BC002655.2 183-1639
1915-2112 AL353572.13 64637-64834 c
2113-2300 AI479563.1 1-188 c
2301-2315 BM982394.1 2-16 c
FEATURES Location/Qualifiers
source 1..2315
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="9"
/map="9q22.1"
gene 1..2315
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/note="cyclin-dependent kinase 20"
/db_xref="GeneID:23552"
/db_xref="HGNC:21420"
/db_xref="MIM:610076"
exon 1..409
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/inference="alignment:Splign:1.39.8"
variation 108
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/replace="c"
/replace="g"
/db_xref="dbSNP:28364934"
misc_feature 188..190
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/note="upstream in-frame stop codon"
CDS 335..1162
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/EC_number="2.7.11.22"
/note="isoform 4 is encoded by transcript variant 4; cell
division protein kinase 20; CAK-kinase p42; CDK-activating
kinase p42; cyclin-kinase-activating kinase p42;
cyclin-dependent protein kinase H; cell cycle-related
kinase"
/codon_start=1
/product="cyclin-dependent kinase 20 isoform 4"
/protein_id="NP_001164110.1"
/db_xref="GI:282402175"
/db_xref="GeneID:23552"
/db_xref="HGNC:21420"
/db_xref="MIM:610076"
/translation="
MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKLPCLPIHLSCRFLSV
"
misc_feature 335..1111
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/note="cyclin-dependent kinase A; Provisional; Region:
PLN00009"
/db_xref="CDD:177649"
misc_feature 341..1114
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/note="Catalytic domain of the Serine/Threonine Kinase,
Cell Cycle-Related Kinase; Region: STKc_CCRK; cd07832"
/db_xref="CDD:173736"
misc_feature order(362..373,386..388,425..427,431..433,482..484,
527..529,575..586,593..595,599..604,713..715,719..721,
725..730,734..736,767..769,776..778,815..817,821..832,
887..889)
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/note="active site"
/db_xref="CDD:173736"
misc_feature order(362..373,386..388,425..427,431..433,527..529,
575..586,593..595,602..604,725..730,734..736,767..769)
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:173736"
misc_feature order(482..484,599..601,713..715,719..721,776..778,
815..817,821..832,887..889)
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/note="substrate binding site [chemical binding]; other
site"
/db_xref="CDD:173736"
misc_feature order(764..799,812..835)
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/note="activation loop (A-loop); other site"
/db_xref="CDD:173736"
exon 410..523
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/inference="alignment:Splign:1.39.8"
exon 524..712
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/inference="alignment:Splign:1.39.8"
variation 591
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/replace="c"
/replace="t"
/db_xref="dbSNP:28364953"
variation 619
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/replace="a"
/replace="c"
/db_xref="dbSNP:3750491"
exon 713..834
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/inference="alignment:Splign:1.39.8"
variation 743
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/replace="a"
/replace="g"
/db_xref="dbSNP:28364955"
exon 835..958
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/inference="alignment:Splign:1.39.8"
variation 886
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/replace="a"
/replace="g"
/db_xref="dbSNP:28364959"
exon 959..1114
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/inference="alignment:Splign:1.39.8"
variation 1113
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/replace="a"
/replace="g"
/db_xref="dbSNP:28364963"
exon 1115..2305
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/inference="alignment:Splign:1.39.8"
variation 1437
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/replace="c"
/replace="t"
/db_xref="dbSNP:3750492"
variation 1726
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/replace="a"
/replace="g"
/db_xref="dbSNP:28364970"
STS 1874..2022
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/standard_name="WIAF-2079"
/db_xref="UniSTS:8848"
STS 1922..2087
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/standard_name="A005E17"
/db_xref="UniSTS:40615"
variation 2089
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
/replace="a"
/replace="g"
/db_xref="dbSNP:28364971"
polyA_signal 2114..2119
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
polyA_site 2135
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
polyA_signal 2272..2277
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
polyA_site 2305
/gene="CDK20"
/gene_synonym="CCRK; CDCH; P42; PNQALRE"
ORIGIN
gggggcgggggcagataggaggtgcctgctgtcatcgttccgtgggccctgctgcgggcacgctctcggcgcatgcgttttttatgcgggattaagcttgctgctgcgtgacagcggagggctaggaaaaggcgcagtggggcccggagctgtcacccctgactcgacgcagcttccgttctcctggtgacgtcgcctacaggaaccgccccagtggtcagctgccgcgctgttgctaggcaacagcgtgcgagctcagatcagcgtggggtggaggagaagtggagtttggaagttcaggggcacaggggcacaggcccacgactgcagcgggatggaccagtactgcatcctgggccgcatcggggagggcgcccacggcatcgtcttcaaggccaagcacgtggagactggcgagatagttgccctcaagaaggtggccctaaggcggttggaggacggcttccctaaccaggccctgcgggagattaaggctctgcaggagatggaggacaatcagtatgtggtacaactgaaggctgtgttcccacacggtggaggctttgtgctggcctttgagttcatgctgtcggatctggccgaggtggtgcgccatgcccagaggccactagcccaggcacaggtcaagagctacctgcagatgctgctcaagggtgtcgccttctgccatgccaacaacattgtacatcgggacctgaaacctgccaacctgctcatcagcgcctcaggccagctcaagatagcggactttggcctggctcgagtcttttccccagacggcagccgcctctacacacaccaggtggccaccaggtctgtgggctgcatcatgggggagctgttgaatgggtccccccttttcccgggcaagaacgatattgaacagctttgctatgtgcttcgcatcttgggcaccccaaaccctcaagtctggccggagctcactgagctgccggactacaacaagatctcctttaaggagcaggtgcccatgcccctggaggaggtgctgcctgacgtctctccccaggcattggatctgctgggtcaattccttctctaccctcctcaccagcgcatcgcagcttccaagctcccctgcctgcccatccatctgagctgccgattcctcagcgtctagggggacctgcccccaaggcccatccagggcccccccacatccatgacttccacgtggaccggcctcttgaggagtcgctgttgaacccagagctgattcggcccttcatcctggaggggtgagaagttggccctggtcccgtctgcctgctcctcaggaccactcagtccacctgttcctctgccacctgcctggcttcaccctccaaggcctccccatggccacagtgggcccacaccacaccctgccccttagcccttgcgagggttggtctcgaggcagaggtcatgttcccagccaagagtatgagaacatccagtcgagcagaggagattcatggcctgtgctcggtgagccttaccttctgtgtgctactgacgtacccatcaggacagtgagctctgctgccagtcaaggcctgcatatgcagaatgacgatgcctgccttggtgctgcttccccgagtgctgcctcctggtcaaggagaagtgcagagagtaaggtgtccttatgttggaaactcaagtggaaggaagatttggtttggttttattctcagagccattaaacactagttcagtatgtgagatatagattctaaaaacctcaggtggctctgccttatgtctgttcctccttcatttctctcaagggaaatggctaaggtggcattgtctcatggctctcgtttttggggtcatggggagggtagcaccaggcatagccacttttgccctgagggactcctgtgtacttcacatcactgagcactcatttagaagtgagggagacagaagtctaggcccagggatggctccagttggggatccagcaggagaccctctgcacatgaggctggtttaccaacatctactccctcaggatgagcgtgagccagaagcagctgtgtatttaaggaaacaagcgttcctggaattaatttataaatttaataaatcccaatataatcccagctagtgctttttccttattataatttgataaggtgattataaaagatacatggaaggaagtggaaccagatgcagaagaggaaatgatggaaggacttacggtatcagataccaatatttaaaagtttgtataataataaagagtatgattgtggttcaaggataaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:23552 -> Molecular function: GO:0004693 [cyclin-dependent protein serine/threonine kinase activity] evidence: IEA
GeneID:23552 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:23552 -> Molecular function: GO:0005524 [ATP binding] evidence: IEA
GeneID:23552 -> Biological process: GO:0007275 [multicellular organismal development] evidence: IEA
GeneID:23552 -> Biological process: GO:0051301 [cell division] evidence: IEA
GeneID:23552 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
GeneID:23552 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
GeneID:23552 -> Cellular component: GO:0005929 [cilium] evidence: IEA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_001164110 -> EC 2.7.11.22
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.