Home |
Help |
Advanced search
2025-05-09 19:17:25, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001025596 4474 bp mRNA linear PRI 24-JUN-2013
DEFINITION Homo sapiens CUGBP, Elav-like family member 1 (CELF1), transcript
variant 3, mRNA.
ACCESSION NM_001025596
VERSION NM_001025596.2 GI:289547564
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 4474)
AUTHORS Yu,T.X., Rao,J.N., Zou,T., Liu,L., Xiao,L., Ouyang,M., Cao,S.,
Gorospe,M. and Wang,J.Y.
TITLE Competitive binding of CUGBP1 and HuR to occludin mRNA controls its
translation and modulates epithelial barrier function
JOURNAL Mol. Biol. Cell 24 (2), 85-99 (2013)
PUBMED 23155001
REMARK GeneRIF: CUGBP1 represses occludin translation by increasing
occludin mRNA recruitment to P-bodies.
REFERENCE 2 (bases 1 to 4474)
AUTHORS Khaziapoul,S., Pearson,M.J., Pryme,I.F., Stern,B. and Hesketh,J.E.
TITLE CUG binding protein 1 binds to a specific region within the human
albumin 3' untranslated region
JOURNAL Biochem. Biophys. Res. Commun. 426 (4), 539-543 (2012)
PUBMED 22982313
REMARK GeneRIF: The results suggest that CUG-BP1 binds to nucleotides
51-100 of the human albumin 3'UTR. In human cells CUG-BP1 binding
may thus play a role in regulation of albumin expression and,
additionally, it may have a function in post-transcriptional
control in CHO cells.
REFERENCE 3 (bases 1 to 4474)
AUTHORS Chang,E.T., Donahue,J.M., Xiao,L., Cui,Y., Rao,J.N., Turner,D.J.,
Twaddell,W.S., Wang,J.Y. and Battafarano,R.J.
TITLE The RNA-binding protein CUG-BP1 increases survivin expression in
oesophageal cancer cells through enhanced mRNA stability
JOURNAL Biochem. J. 446 (1), 113-123 (2012)
PUBMED 22646166
REMARK GeneRIF: CUG-BP1 is overexpressed in oesophageal cancer cell lines
and human oesophageal cancer specimens. CUG-BP1 associates with the
3'-untranslated region of survivin mRNA.
REFERENCE 4 (bases 1 to 4474)
AUTHORS Beisang,D., Rattenbacher,B., Vlasova-St Louis,I.A. and
Bohjanen,P.R.
TITLE Regulation of CUG-binding protein 1 (CUGBP1) binding to target
transcripts upon T cell activation
JOURNAL J. Biol. Chem. 287 (2), 950-960 (2012)
PUBMED 22117072
REMARK GeneRIF: CUGBP1 binding to certain GRE-containing target
transcripts decreased following T cell activation through
activation-dependent phosphorylation of CUGBP1.
REFERENCE 5 (bases 1 to 4474)
AUTHORS Masuda,A., Andersen,H.S., Doktor,T.K., Okamoto,T., Ito,M.,
Andresen,B.S. and Ohno,K.
TITLE CUGBP1 and MBNL1 preferentially bind to 3' UTRs and facilitate mRNA
decay
JOURNAL Sci Rep 2, 209 (2012)
PUBMED 22355723
REMARK GeneRIF: study suggests that regulation of CUGBP1 and MBNL1 is
essential for accurate control of destabilization of a broad
spectrum of mRNAs as well as of alternative splicing events
REFERENCE 6 (bases 1 to 4474)
AUTHORS Michalowski,S., Miller,J.W., Urbinati,C.R., Paliouras,M.,
Swanson,M.S. and Griffith,J.
TITLE Visualization of double-stranded RNAs from the myotonic dystrophy
protein kinase gene and interactions with CUG-binding protein
JOURNAL Nucleic Acids Res. 27 (17), 3534-3542 (1999)
PUBMED 10446244
REFERENCE 7 (bases 1 to 4474)
AUTHORS Roberts,R., Timchenko,N.A., Miller,J.W., Reddy,S., Caskey,C.T.,
Swanson,M.S. and Timchenko,L.T.
TITLE Altered phosphorylation and intracellular distribution of a (CUG)n
triplet repeat RNA-binding protein in patients with myotonic
dystrophy and in myotonin protein kinase knockout mice
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 94 (24), 13221-13226 (1997)
PUBMED 9371827
REFERENCE 8 (bases 1 to 4474)
AUTHORS Timchenko,L.T., Miller,J.W., Timchenko,N.A., DeVore,D.R.,
Datar,K.V., Lin,L., Roberts,R., Caskey,C.T. and Swanson,M.S.
TITLE Identification of a (CUG)n triplet repeat RNA-binding protein and
its expression in myotonic dystrophy
JOURNAL Nucleic Acids Res. 24 (22), 4407-4414 (1996)
PUBMED 8948631
REFERENCE 9 (bases 1 to 4474)
AUTHORS Bhagavati,S., Ghatpande,A. and Leung,B.
TITLE Identification of two nuclear proteins which bind to RNA CUG
repeats: significance for myotonic dystrophy
JOURNAL Biochem. Biophys. Res. Commun. 228 (1), 55-62 (1996)
PUBMED 8912635
REMARK Erratum:[Biochem Biophys Res Commun. 2008 Jun;370(3):530. Bhagwati,
S [corrected to Bhagavati, S]]
REFERENCE 10 (bases 1 to 4474)
AUTHORS Timchenko,L.T., Timchenko,N.A., Caskey,C.T. and Roberts,R.
TITLE Novel proteins with binding specificity for DNA CTG repeats and RNA
CUG repeats: implications for myotonic dystrophy
JOURNAL Hum. Mol. Genet. 5 (1), 115-121 (1996)
PUBMED 8789448
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AF267534.1, AJ007988.1,
AK307679.1, AC090559.7 and BM737883.1.
On Feb 24, 2010 this sequence version replaced gi:71164870.
Summary: Members of the CELF/BRUNOL protein family contain two
N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM
domain, and a divergent segment of 160-230 aa between the second
and third RRM domains. Members of this protein family regulate
pre-mRNA alternative splicing and may also be involved in mRNA
editing, and translation. This gene may play a role in myotonic
dystrophy type 1 (DM1) via interactions with the dystrophia
myotonica-protein kinase (DMPK) gene. Alternative splicing results
in multiple transcript variants encoding different isoforms.
[provided by RefSeq, Jul 2008].
Transcript Variant: This variant (3) uses a different splice site
in its coding region compared to variant 1. The resulting isoform
(3) has 4 additional internal amino acids compared to isoform 1.
Sequence Note: This RefSeq record was created from transcript and
genomic sequence data to make the sequence consistent with the
reference genome assembly. The genomic coordinates used for the
transcript record were based on transcript alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AF267533.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025081, ERS025082 [ECO:0000350]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-10 AF267534.1 2-11
11-1471 AJ007988.1 1-1461
1472-2118 AK307679.1 934-1580
2119-4400 AC090559.7 90475-92756 c
4401-4474 BM737883.1 164-237
FEATURES Location/Qualifiers
source 1..4474
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="11"
/map="11p11"
gene 1..4474
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/note="CUGBP, Elav-like family member 1"
/db_xref="GeneID:10658"
/db_xref="HGNC:2549"
/db_xref="HPRD:03046"
/db_xref="MIM:601074"
exon 1..188
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/inference="alignment:Splign:1.39.8"
CDS 11..1471
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/note="isoform 3 is encoded by transcript variant 3; CUG
RNA-binding protein; embryo deadenylation element binding
protein; CUG triplet repeat, RNA binding protein 1; CUG
triplet repeat, RNA-binding protein 1; nuclear
polyadenylated RNA-binding protein, 50-kD; bruno-like 2;
CUG-BP- and ETR-3-like factor 1; CELF-1; CUG-BP1; EDEN-BP
homolog; bruno-like protein 2; deadenylation factor
CUG-BP; RNA-binding protein BRUNOL-2; CUG triplet repeat
RNA-binding protein 1; 50 kDa nuclear polyadenylated
RNA-binding protein; embryo deadenylation element-binding
protein homolog"
/codon_start=1
/product="CUGBP Elav-like family member 1 isoform 3"
/protein_id="NP_001020767.1"
/db_xref="GI:71164871"
/db_xref="CCDS:CCDS31482.1"
/db_xref="GeneID:10658"
/db_xref="HGNC:2549"
/db_xref="HPRD:03046"
/db_xref="MIM:601074"
/translation="
MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALYLQLLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY
"
misc_feature 59..298
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/note="RRM (RNA recognition motif), also known as RBD (RNA
binding domain) or RNP (ribonucleoprotein domain), is a
highly abundant domain in eukaryotes found in proteins
involved in post-transcriptional gene expression processes
including mRNA and rRNA...; Region: RRM; cd00590"
/db_xref="CDD:100104"
misc_feature order(65..67,191..193,197..199)
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/note="RNA/DNA binding site [nucleotide binding]; other
site"
/db_xref="CDD:100104"
misc_feature 290..298
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/note="RRM dimerization site [polypeptide binding]; other
site"
/db_xref="CDD:100104"
misc_feature 335..565
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/note="RRM (RNA recognition motif), also known as RBD (RNA
binding domain) or RNP (ribonucleoprotein domain), is a
highly abundant domain in eukaryotes found in proteins
involved in post-transcriptional gene expression processes
including mRNA and rRNA...; Region: RRM; cd00590"
/db_xref="CDD:100104"
misc_feature order(341..343,458..460,464..466)
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/note="RNA/DNA binding site [nucleotide binding]; other
site"
/db_xref="CDD:100104"
misc_feature 557..565
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/note="RRM dimerization site [polypeptide binding]; other
site"
/db_xref="CDD:100104"
misc_feature 1214..1438
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/note="RRM (RNA recognition motif), also known as RBD (RNA
binding domain) or RNP (ribonucleoprotein domain), is a
highly abundant domain in eukaryotes found in proteins
involved in post-transcriptional gene expression processes
including mRNA and rRNA...; Region: RRM; cd00590"
/db_xref="CDD:100104"
misc_feature order(1220..1222,1340..1342,1346..1348)
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/note="RNA/DNA binding site [nucleotide binding]; other
site"
/db_xref="CDD:100104"
misc_feature 1430..1438
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/note="RRM dimerization site [polypeptide binding]; other
site"
/db_xref="CDD:100104"
exon 189..271
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/inference="alignment:Splign:1.39.8"
exon 272..320
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/inference="alignment:Splign:1.39.8"
exon 321..455
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/inference="alignment:Splign:1.39.8"
STS 366..509
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/standard_name="MARC_11599-11600:1002739035:1"
/db_xref="UniSTS:267239"
exon 456..535
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/inference="alignment:Splign:1.39.8"
exon 536..697
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/inference="alignment:Splign:1.39.8"
exon 698..773
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/inference="alignment:Splign:1.39.8"
exon 774..902
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/inference="alignment:Splign:1.39.8"
STS 851..1450
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/standard_name="Cugbp1"
/db_xref="UniSTS:479088"
exon 903..1013
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/inference="alignment:Splign:1.39.8"
exon 1014..1199
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/inference="alignment:Splign:1.39.8"
exon 1200..1343
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/inference="alignment:Splign:1.39.8"
STS 1219..1334
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/standard_name="X61451"
/db_xref="UniSTS:125827"
variation 1297
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/replace="g"
/replace="t"
/db_xref="dbSNP:34097581"
exon 1344..1510
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/inference="alignment:Splign:1.39.8"
exon 1511..4465
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/inference="alignment:Splign:1.39.8"
STS 1560..2198
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/standard_name="CUGBP1_2383"
/db_xref="UniSTS:280629"
STS 2201..2386
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/standard_name="STS-N31747"
/db_xref="UniSTS:38745"
variation 3568
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/replace="a"
/replace="c"
/db_xref="dbSNP:11546837"
STS 3601..3731
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/standard_name="RH25600"
/db_xref="UniSTS:84245"
variation 3828
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/replace="a"
/replace="g"
/db_xref="dbSNP:1062801"
variation 3840
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/replace="a"
/replace="g"
/db_xref="dbSNP:1062802"
STS 4191..4396
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/standard_name="RH36605"
/db_xref="UniSTS:82577"
variation 4214
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
/replace="c"
/replace="t"
/db_xref="dbSNP:1044269"
polyA_signal 4446..4451
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
polyA_site 4462
/gene="CELF1"
/gene_synonym="BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP;
hNab50; NAB50; NAPOR"
ORIGIN
ctcaaagaaaatgaacggcaccctggaccacccagaccaaccagatcttgatgctatcaagatgtttgtgggccaggttccaaggacctggtctgaaaaggacttgcgggaactcttcgaacagtatggtgctgtgtatgaaatcaacgtcctaagggataggagccaaaacccgcctcagagcaaagggtgctgttttgttacattttacacccgtaaagctgcattagaagctcagaatgctcttcacaacatgaaagtcctcccagggatgcatcaccctatacagatgaaacctgctgacagtgagaagaacaatgcagtggaagacaggaagctgtttattggtatgatttccaagaagtgcactgaaaatgacatccgagtcatgttctcttcgtttggacagattgaagaatgccggatattgcggggacctgatggcctgagccgaggttgtgcatttgtgacttttacaacaagagccatggcacagacggctatcaaggcaatgcaccaagcacagaccatggagggttgctcatcacccatggtggtaaaatttgctgatacacagaaggacaaagaacagaagagaatggcccagcagctccagcagcagatgcagcaaatcagcgcagcatctgtgtggggaaaccttgctggtctaaatactcttggaccccagtatttagcactttatttgcagctccttcagcagactgcctcctctgggaacctcaacaccctgagcagcctccacccaatgggagggttgaatgcaatgcagttacagaatttggctgcactagctgctgcagctagtgcagctcagaacacaccaagtggtaccaatgctctcactacatccagcagtcccctcagcgtgctcactagttcagggtcctcacctagctctagcagcagtaattctgtcaaccccatagcctcacttggagccctgcagacattagctggagcaacggctggcctcaatgttggctctttggcaggaatggctgctttaaatggtggcctgggcagcagtggcctttccaatggcaccgggagcaccatggaggccctcactcaggcctactcgggtatccagcaatatgctgctgctgcgctccccactctgtacaaccagaatcttctgacacagcagagtattggtgctgctggaagccagaaggaaggtccagagggagccaacctgttcatctaccacctgccccaggagtttggtgatcaggacctgctgcagatgtttatgccctttgggaatgtcgtgtctgccaaggttttcatagacaagcagacaaacctgagcaagtgttttggttttgtaagttacgacaatcctgtttcggcccaagctgccatccagtccatgaacggctttcagattggcatgaagcggcttaaagtgcagctcaaacgttcgaagaatgacagcaagccctactgagcgtgctcccctctgagactggagtgagagggtcttctgattcctgccgtttgttcatcgttgtgcctaaagcatgtcgatgtggcgtcaagtacatcgtccaaatccctgtctcttcagcttctctgatgcttgaactctcacctttgaccttgtgttgacctttgatgctgatgtgtatttttattatgtttgtttctttcttcgtttttttttctttttttctttcctttttttttccttttgtgctgccaaattggttttgctagaacgactgctgaaggggaaatatttaaacttgcatttgaatataaaaaaaatctatttttctagaacttcataagataaccacttgattttgtgattccaattctttgtaattgtcttcagagcagccctactagcacataccgcgtggtgtttgtatttctgtgaacacacagccagtccgtttctaggctttgtttctctgtgtgcttagttttaaagacaactttgaagtaaacaatgaaataaaagatgtcactaaaacctctgaggctcctgagcacattttgctgatacagtctgtggggcttgaggagaccgcatgtattgttctttcttttgtttttcttctgagttctcaactgcggagagcacctgaaccccctttcctttttgaccgcaggctgcactttgggccccagccagccctttttctttttctttttcttttgtggttcttccctggagcgactctggggagtcctggatatcccgcctgccccttcccctcagccccatgcttgttccaacagtctccacagcaaaatgtgatgctttgatttttttgttgttgtttttgtttttgtattgtttttgtgtttttgttttgaattttttcctttcctactaagattatgcccagaaaaaagttttgcatgtttcctgctgtttcttcacaccttcgtatatatcaccttcacctctctgttttctatagtttgtgcaaaaactgatcgatttaaaagggtttcaaagaagctgttttaaattgttgtagggttgattatttttttcaagattgtattgtttaattttgaagtggcaactttctcctctattgcccttagagcgtttgcctgtgcacttagactgtcacttcgtgtggcctccaggtcttaccggggcttccgggaggctggctgctttgctcagagagggtgggaagggggcctggagagacacgagaagcagaggtagagcctagaaggtggcagcaggtgggtaagaggcttatttagcacattaggggcagtgagcacctggaggaaggagggcgctcccaatcacccgtaggaggccatctgcacaccaagcggcaattcacctgctggcgcttttcctaggtgacaagcacaatactacagtcttcacactgtttacagccctgggcaccagccacccggcactggctcttcatcacagctctgctcttgcttagctagtggggtgggggaaagggcagggatttgtttttttaattgggtggagagccaaacagctactgtccctgggtgccaagcaagccagttttttggttccctgagggaaactgaccctcctctcttgtggcaccatccagcctcagggtcttggagacttgagtaagaatgtgagtggagggggagaggtgaggagaggagcacagggtggatctgtggagggaagaggttacagggggaggagctgatgatagatcccacccagacttaagctgctggtgggtgggtgagctgggaagtaggactgtccagggaagggtggagagatgtagctaggggctggggagggggaggtggaagcgctattgagcatcctccacaccaaggttgatgaaggaagggatcccagcagggtttctgctctggggctggcaggttgcctggtattatgcccaaggccgctctgcctgggggaaagggcagccaggcagaggcccagtgtctggtaggctgctgaatttcctggaaggggtgattggatggaaagaggccagaaaccccagcctgagagactgctgtgcaccccacagtctgactgcacagagccgcctctgttggcaggaggcactgaggctccccttcctgtgtattgagaagcagtgtttgccaatatattttgctttcaattccaagaggagctctgggaaaacctgtggataaaaccaaatgccaaatgttggacgttgtttccttttccttttctctctctgattgttttaattgttctgtggtggttttaatggatttgagaccctggagcggcagctgcctttctgatttccagctgctttttgtgaataatttaaaaagaaaaaaaaaaagaaactttacattttggagacaaacctgtgtgagttttttattggtacaaacgttgtatttaacactaggggttttgtacagttttttgccttttctactagaaaacaatgtaaagtgatttcacaatgtgaagagaaaaaaaaattgccactatgaccaaacgcacagtctgttctgcagcaacaacgggattcaatcaactcagtcgtgattcagccgtagaaatgcttttcctttatcttgtttgagcttttcctttctttcctgttttgatttgcaaaagaaaatgtcttttttgtgtgaacttgtgttgtactctgtagaaaattatggattttactttaatggtttaaaaaaaggcaaggagagccctcgtcgcttttcttacctaatcacagagtttgtgtagtgaatttaaaaagaaaaaaaaattgttataagtttggagcaagggagtatgtgtttcaaaggaatctccttcctttttttgtgtgtttttccttttgtcccaatggggaacctaaatctgttttaattgcacagacacatggacaaaaagtcattttgtatctgccaagtgtggtaccttcctttgtttatttgctattaaactgtttgagaagaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:10658 -> Molecular function: GO:0000166 [nucleotide binding] evidence: IEA
GeneID:10658 -> Molecular function: GO:0000900 [translation repressor activity, nucleic acid binding] evidence: NAS
GeneID:10658 -> Molecular function: GO:0003723 [RNA binding] evidence: IDA
GeneID:10658 -> Molecular function: GO:0003729 [mRNA binding] evidence: IDA
GeneID:10658 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:10658 -> Molecular function: GO:0031369 [translation initiation factor binding] evidence: IEA
GeneID:10658 -> Molecular function: GO:0042835 [BRE binding] evidence: IDA
GeneID:10658 -> Biological process: GO:0006376 [mRNA splice site selection] evidence: ISS
GeneID:10658 -> Biological process: GO:0006397 [mRNA processing] evidence: TAS
GeneID:10658 -> Biological process: GO:0007281 [germ cell development] evidence: NAS
GeneID:10658 -> Biological process: GO:0007286 [spermatid development] evidence: IEA
GeneID:10658 -> Biological process: GO:0009790 [embryo development] evidence: NAS
GeneID:10658 -> Biological process: GO:0016246 [RNA interference] evidence: NAS
GeneID:10658 -> Biological process: GO:0040018 [positive regulation of multicellular organism growth] evidence: IEA
GeneID:10658 -> Biological process: GO:0043484 [regulation of RNA splicing] evidence: IDA
GeneID:10658 -> Cellular component: GO:0005634 [nucleus] evidence: NAS
GeneID:10658 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
GeneID:10658 -> Cellular component: GO:0030529 [ribonucleoprotein complex] evidence: NAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.