Home |
Help |
Advanced search
2025-05-09 19:07:56, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_000576 1498 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens interleukin 1, beta (IL1B), mRNA.
ACCESSION NM_000576
VERSION NM_000576.2 GI:27894305
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1498)
AUTHORS Clerigues,V., Murphy,C.L., Guillen,M.I. and Alcaraz,M.J.
TITLE Haem oxygenase-1 induction reverses the actions of
interleukin-1beta on hypoxia-inducible transcription factors and
human chondrocyte metabolism in hypoxia
JOURNAL Clin. Sci. 125 (2), 99-108 (2013)
PUBMED 23406266
REMARK GeneRIF: HO-1 down-regulation is involved in the inhibition of SOX9
and COL2A1 expression by IL-1beta.
REFERENCE 2 (bases 1 to 1498)
AUTHORS Nieuwenhuizen,L., Falkenburg,W.J., Schutgens,R.E., Roosendaal,G.,
van Veghel,K., Biesma,D.H. and Lafeber,F.P.
TITLE Stimulation of naive monocytes and PBMCs with coagulation proteases
results in thrombin-mediated and PAR-1-dependent cytokine release
and cell proliferation in PBMCs only
JOURNAL Scand. J. Immunol. 77 (5), 339-349 (2013)
PUBMED 23421536
REMARK GeneRIF: Data indicate that thrombin-induced IL-1ss and IL-6
cytokine release in naive PBMCs is PAR-1-dependent.
REFERENCE 3 (bases 1 to 1498)
AUTHORS Hashimoto,K., Otero,M., Imagawa,K., de Andres,M.C., Coico,J.M.,
Roach,H.I., Oreffo,R.O., Marcu,K.B. and Goldring,M.B.
TITLE Regulated transcription of human matrix metalloproteinase 13
(MMP13) and interleukin-1beta (IL1B) genes in chondrocytes depends
on methylation of specific proximal promoter CpG sites
JOURNAL J. Biol. Chem. 288 (14), 10061-10072 (2013)
PUBMED 23417678
REMARK GeneRIF: methylation of different CpG sites in the proximal
promoters of the human MMP13 and IL1B genes modulates their
transcription by distinct mechanisms
REFERENCE 4 (bases 1 to 1498)
AUTHORS Yucel,O.O., Berker,E., Mescil,L., Eratalay,K., Tepe,E. and
Tezcan,I.
TITLE Association of interleukin-1 beta (+3954) gene polymorphism and
gingival crevicular fluid levels in patients with aggressive and
chronic periodontitis
JOURNAL Genet. Couns. 24 (1), 21-35 (2013)
PUBMED 23610862
REMARK GeneRIF: Interleukin-1 beta is thought to play an important role in
the pathogenesis of periodontal disease.
REFERENCE 5 (bases 1 to 1498)
AUTHORS Brochu,C., Cabrita,M.A., Melanson,B.D., Hamill,J.D., Lau,R.,
Pratt,M.A. and McKay,B.C.
TITLE NF-kappaB-dependent role for cold-inducible RNA binding protein in
regulating interleukin 1beta
JOURNAL PLoS ONE 8 (2), E57426 (2013)
PUBMED 23437386
REMARK GeneRIF: RNA interference against cold inducible RNA binding
protein inhibits UV-, LPS- and cisplatin-induced expression of
interleukin 1 through decreased NFkappaB activity.
REFERENCE 6 (bases 1 to 1498)
AUTHORS Nanduri,V.B., Hulmes,J.D., Pan,Y.C., Kilian,P.L. and Stern,A.S.
TITLE The role of arginine residues in interleukin 1 receptor binding
JOURNAL Biochim. Biophys. Acta 1118 (1), 25-35 (1991)
PUBMED 1837236
REFERENCE 7 (bases 1 to 1498)
AUTHORS Grenfell,S., Smithers,N., Witham,S., Shaw,A., Graber,P. and
Solari,R.
TITLE Analysis of mutations in the putative nuclear localization sequence
of interleukin-1 beta
JOURNAL Biochem. J. 280 (PT 1), 111-116 (1991)
PUBMED 1835838
REFERENCE 8 (bases 1 to 1498)
AUTHORS Howard,A.D., Kostura,M.J., Thornberry,N., Ding,G.J., Limjuco,G.,
Weidner,J., Salley,J.P., Hogquist,K.A., Chaplin,D.D., Mumford,R.A.
et al.
TITLE IL-1-converting enzyme requires aspartic acid residues for
processing of the IL-1 beta precursor at two distinct sites and
does not cleave 31-kDa IL-1 alpha
JOURNAL J. Immunol. 147 (9), 2964-2969 (1991)
PUBMED 1919001
REFERENCE 9 (bases 1 to 1498)
AUTHORS Mizutani,H., Schechter,N., Lazarus,G., Black,R.A. and Kupper,T.S.
TITLE Rapid and specific conversion of precursor interleukin 1 beta (IL-1
beta) to an active IL-1 species by human mast cell chymase
JOURNAL J. Exp. Med. 174 (4), 821-825 (1991)
PUBMED 1919436
REFERENCE 10 (bases 1 to 1498)
AUTHORS Chistiakov,D.A., Arsenian,S.G., Braga,E.A., Lapidus,A.D.,
Kozlov,Iu.I., Mashko,S.V., Nosikov,V.V., Sverdlov,E.D. and
Debabov,V.G.
TITLE [Elimination of introns from the interleukin 1 beta genome by DNA
amplification and expression of interleukin 1 beta in Escherichia
coli]
JOURNAL Mol. Biol. (Mosk.) 25 (5), 1273-1284 (1991)
PUBMED 1753956
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from M15330.1.
This sequence is a reference standard in the RefSeqGene project.
On Jan 24, 2003 this sequence version replaced gi:10835144.
Summary: The protein encoded by this gene is a member of the
interleukin 1 cytokine family. This cytokine is produced by
activated macrophages as a proprotein, which is proteolytically
processed to its active form by caspase 1 (CASP1/ICE). This
cytokine is an important mediator of the inflammatory response, and
is involved in a variety of cellular activities, including cell
proliferation, differentiation, and apoptosis. The induction of
cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central
nervous system (CNS) is found to contribute to inflammatory pain
hypersensitivity. This gene and eight other interleukin 1 family
genes form a cytokine gene cluster on chromosome 2. [provided by
RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC008678.1, K02770.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025088 [ECO:0000348]
##Evidence-Data-END##
FEATURES Location/Qualifiers
source 1..1498
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="2"
/map="2q14"
gene 1..1498
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/note="interleukin 1, beta"
/db_xref="GeneID:3553"
/db_xref="HGNC:5992"
/db_xref="HPRD:00985"
/db_xref="MIM:147720"
exon 1..72
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/inference="alignment:Splign:1.39.8"
variation 20
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1133555"
variation 40
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1799916"
variation 49
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1133558"
exon 73..134
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/inference="alignment:Splign:1.39.8"
CDS 88..897
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/note="preinterleukin 1 beta; catabolin;
pro-interleukin-1-beta; IL-1 beta"
/codon_start=1
/product="interleukin-1 beta proprotein"
/protein_id="NP_000567.1"
/db_xref="GI:10835145"
/db_xref="CCDS:CCDS2102.1"
/db_xref="GeneID:3553"
/db_xref="HGNC:5992"
/db_xref="HPRD:00985"
/db_xref="MIM:147720"
/translation="
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
"
misc_feature 88..363
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/note="Interleukin-1 propeptide; Region: IL1_propep;
pfam02394"
/db_xref="CDD:111302"
misc_feature 166..168
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/experiment="experimental evidence, no additional details
recorded"
/note="proteolytic cleavage site; modified site"
/citation=[8]
/db_xref="HPRD:00977"
misc_feature 166..168
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/experiment="experimental evidence, no additional details
recorded"
/note="proteolytic cleavage site; modified site"
/citation=[8]
/db_xref="HPRD:04047"
misc_feature 433..435
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/experiment="experimental evidence, no additional details
recorded"
/note="proteolytic cleavage site; modified site"
/citation=[8]
/db_xref="HPRD:00977"
misc_feature 433..435
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/experiment="experimental evidence, no additional details
recorded"
/note="proteolytic cleavage site; modified site"
/citation=[8]
/db_xref="HPRD:04047"
mat_peptide 436..894
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/product="interleukin-1 beta"
misc_feature 445..447
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/experiment="experimental evidence, no additional details
recorded"
/note="Involved in receptor binding; propagated from
UniProtKB/Swiss-Prot (P01584.2); other site"
misc_feature 454..882
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/note="Interleukin-1 homologes; Cytokines with various
biological functions. Interleukin 1 alpha and beta are
also known as hematopoietin and catabolin. This family
also contains interleukin-1 receptor antagonists
(inhibitors); Region: IL1; cd00100"
/db_xref="CDD:28984"
misc_feature order(460..462,466..468,868..870)
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/note="receptor activation site; other site"
/db_xref="CDD:28984"
misc_feature order(475..480,508..510,514..516,523..525,529..531,
538..540,547..549,571..573,709..717,742..744,748..750,
754..762,823..825)
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/note="receptor binding site; other site"
/db_xref="CDD:28984"
misc_feature 508..510
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/experiment="experimental evidence, no additional details
recorded"
/note="proteolytic cleavage site; modified site"
/db_xref="HPRD:00386"
exon 135..186
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/inference="alignment:Splign:1.39.8"
exon 187..388
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/inference="alignment:Splign:1.39.8"
variation 258
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/replace="c"
/replace="t"
/db_xref="dbSNP:16062"
STS 260..355
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/standard_name="PMC104510P1"
/db_xref="UniSTS:270114"
STS 356..445
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/standard_name="PMC317379P1"
/db_xref="UniSTS:273089"
exon 389..553
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/inference="alignment:Splign:1.39.8"
variation 402
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1143634"
STS 405..552
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/standard_name="RH48318"
/db_xref="UniSTS:80831"
exon 554..684
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/inference="alignment:Splign:1.39.8"
exon 685..1498
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/inference="alignment:Splign:1.39.8"
STS 685..1494
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/standard_name="IL1B_353"
/db_xref="UniSTS:277369"
STS 930..1084
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/standard_name="D2S2849"
/db_xref="UniSTS:75398"
STS 1077..1304
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/standard_name="G10509"
/db_xref="UniSTS:16103"
STS 1101..1314
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/standard_name="PMC305895P1"
/db_xref="UniSTS:272572"
STS 1219..1374
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/standard_name="RH11481"
/db_xref="UniSTS:20953"
variation 1313
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/replace="g"
/replace="t"
/db_xref="dbSNP:15610"
variation 1402
/gene="IL1B"
/gene_synonym="IL-1; IL1-BETA; IL1F2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1071676"
ORIGIN
accaaacctcttcgaggcacaaggcacaacaggctgctctgggattctcttcagccaatcttcattgctcaagtgtctgaagcagccatggcagaagtacctgagctcgccagtgaaatgatggcttattacagtggcaatgaggatgacttgttctttgaagctgatggccctaaacagatgaagtgctccttccaggacctggacctctgccctctggatggcggcatccagctacgaatctccgaccaccactacagcaagggcttcaggcaggccgcgtcagttgttgtggccatggacaagctgaggaagatgctggttccctgcccacagaccttccaggagaatgacctgagcaccttctttcccttcatctttgaagaagaacctatcttcttcgacacatgggataacgaggcttatgtgcacgatgcacctgtacgatcactgaactgcacgctccgggactcacagcaaaaaagcttggtgatgtctggtccatatgaactgaaagctctccacctccagggacaggatatggagcaacaagtggtgttctccatgtcctttgtacaaggagaagaaagtaatgacaaaatacctgtggccttgggcctcaaggaaaagaatctgtacctgtcctgcgtgttgaaagatgataagcccactctacagctggagagtgtagatcccaaaaattacccaaagaagaagatggaaaagcgatttgtcttcaacaagatagaaatcaataacaagctggaatttgagtctgcccagttccccaactggtacatcagcacctctcaagcagaaaacatgcccgtcttcctgggagggaccaaaggcggccaggatataactgacttcaccatgcaatttgtgtcttcctaaagagagctgtacccagagagtcctgtgctgaatgtggactcaatccctagggctggcagaaagggaacagaaaggtttttgagtacggctatagcctggactttcctgttgtctacaccaatgcccaactgcctgccttagggtagtgctaagaggatctcctgtccatcagccaggacagtcagctctctcctttcagggccaatccccagcccttttgttgagccaggcctctctcacctctcctactcacttaaagcccgcctgacagaaaccacggccacatttggttctaagaaaccctctgtcattcgctcccacattctgatgagcaaccgcttccctatttatttatttatttgtttgtttgttttattcattggtctaatttattcaaagggggcaagaagtagcagtgtctgtaaaagagcctagtttttaatagctatggaatcaattcaatttggactggtgtgctctctttaaatcaagtcctttaattaagactgaaaatatataagctcagattatttaaatgggaatatttataaatgagcaaatatcatactgttcaatggttctgaaataaacttcactgaag
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:3553 -> Molecular function: GO:0005125 [cytokine activity] evidence: IDA
GeneID:3553 -> Molecular function: GO:0005125 [cytokine activity] evidence: IMP
GeneID:3553 -> Molecular function: GO:0005149 [interleukin-1 receptor binding] evidence: NAS
GeneID:3553 -> Molecular function: GO:0008083 [growth factor activity] evidence: IEA
GeneID:3553 -> Molecular function: GO:0019904 [protein domain specific binding] evidence: IPI
GeneID:3553 -> Biological process: GO:0000165 [MAPK cascade] evidence: IMP
GeneID:3553 -> Biological process: GO:0000187 [activation of MAPK activity] evidence: IDA
GeneID:3553 -> Biological process: GO:0001660 [fever generation] evidence: IEA
GeneID:3553 -> Biological process: GO:0001934 [positive regulation of protein phosphorylation] evidence: IDA
GeneID:3553 -> Biological process: GO:0001934 [positive regulation of protein phosphorylation] evidence: NAS
GeneID:3553 -> Biological process: GO:0002711 [positive regulation of T cell mediated immunity] evidence: IC
GeneID:3553 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:3553 -> Biological process: GO:0006954 [inflammatory response] evidence: IDA
GeneID:3553 -> Biological process: GO:0006954 [inflammatory response] evidence: NAS
GeneID:3553 -> Biological process: GO:0006955 [immune response] evidence: IEA
GeneID:3553 -> Biological process: GO:0007165 [signal transduction] evidence: TAS
GeneID:3553 -> Biological process: GO:0007267 [cell-cell signaling] evidence: TAS
GeneID:3553 -> Biological process: GO:0007566 [embryo implantation] evidence: TAS
GeneID:3553 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: IDA
GeneID:3553 -> Biological process: GO:0010575 [positive regulation vascular endothelial growth factor production] evidence: IDA
GeneID:3553 -> Biological process: GO:0010575 [positive regulation vascular endothelial growth factor production] evidence: ISS
GeneID:3553 -> Biological process: GO:0010829 [negative regulation of glucose transport] evidence: ISS
GeneID:3553 -> Biological process: GO:0014805 [smooth muscle adaptation] evidence: NAS
GeneID:3553 -> Biological process: GO:0019221 [cytokine-mediated signaling pathway] evidence: IDA
GeneID:3553 -> Biological process: GO:0030213 [hyaluronan biosynthetic process] evidence: IDA
GeneID:3553 -> Biological process: GO:0030593 [neutrophil chemotaxis] evidence: IEA
GeneID:3553 -> Biological process: GO:0030730 [sequestering of triglyceride] evidence: IDA
GeneID:3553 -> Biological process: GO:0030949 [positive regulation of vascular endothelial growth factor receptor signaling pathway] evidence: IC
GeneID:3553 -> Biological process: GO:0031622 [positive regulation of fever generation] evidence: ISS
GeneID:3553 -> Biological process: GO:0031663 [lipopolysaccharide-mediated signaling pathway] evidence: IDA
GeneID:3553 -> Biological process: GO:0032308 [positive regulation of prostaglandin secretion] evidence: ISS
GeneID:3553 -> Biological process: GO:0032611 [interleukin-1 beta production] evidence: IEA
GeneID:3553 -> Biological process: GO:0032725 [positive regulation of granulocyte macrophage colony-stimulating factor production] evidence: IDA
GeneID:3553 -> Biological process: GO:0032729 [positive regulation of interferon-gamma production] evidence: IDA
GeneID:3553 -> Biological process: GO:0032755 [positive regulation of interleukin-6 production] evidence: TAS
GeneID:3553 -> Biological process: GO:0032757 [positive regulation of interleukin-8 production] evidence: IDA
GeneID:3553 -> Biological process: GO:0033129 [positive regulation of histone phosphorylation] evidence: NAS
GeneID:3553 -> Biological process: GO:0033198 [response to ATP] evidence: IEA
GeneID:3553 -> Biological process: GO:0034116 [positive regulation of heterotypic cell-cell adhesion] evidence: IDA
GeneID:3553 -> Biological process: GO:0034116 [positive regulation of heterotypic cell-cell adhesion] evidence: NAS
GeneID:3553 -> Biological process: GO:0035066 [positive regulation of histone acetylation] evidence: NAS
GeneID:3553 -> Biological process: GO:0035505 [positive regulation of myosin light chain kinase activity] evidence: IDA
GeneID:3553 -> Biological process: GO:0035690 [cellular response to drug] evidence: IDA
GeneID:3553 -> Biological process: GO:0042102 [positive regulation of T cell proliferation] evidence: IDA
GeneID:3553 -> Biological process: GO:0042346 [positive regulation of NF-kappaB import into nucleus] evidence: IDA
GeneID:3553 -> Biological process: GO:0043122 [regulation of I-kappaB kinase/NF-kappaB cascade] evidence: IDA
GeneID:3553 -> Biological process: GO:0043123 [positive regulation of I-kappaB kinase/NF-kappaB cascade] evidence: IEA
GeneID:3553 -> Biological process: GO:0043407 [negative regulation of MAP kinase activity] evidence: ISS
GeneID:3553 -> Biological process: GO:0043491 [protein kinase B signaling cascade] evidence: IMP
GeneID:3553 -> Biological process: GO:0045080 [positive regulation of chemokine biosynthetic process] evidence: IEA
GeneID:3553 -> Biological process: GO:0045086 [positive regulation of interleukin-2 biosynthetic process] evidence: IMP
GeneID:3553 -> Biological process: GO:0045410 [positive regulation of interleukin-6 biosynthetic process] evidence: IEA
GeneID:3553 -> Biological process: GO:0045429 [positive regulation of nitric oxide biosynthetic process] evidence: IDA
GeneID:3553 -> Biological process: GO:0045766 [positive regulation of angiogenesis] evidence: ISS
GeneID:3553 -> Biological process: GO:0045833 [negative regulation of lipid metabolic process] evidence: ISS
GeneID:3553 -> Biological process: GO:0045840 [positive regulation of mitosis] evidence: IMP
GeneID:3553 -> Biological process: GO:0045893 [positive regulation of transcription, DNA-dependent] evidence: IDA
GeneID:3553 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IEA
GeneID:3553 -> Biological process: GO:0046330 [positive regulation of JNK cascade] evidence: IEA
GeneID:3553 -> Biological process: GO:0046627 [negative regulation of insulin receptor signaling pathway] evidence: ISS
GeneID:3553 -> Biological process: GO:0046827 [positive regulation of protein export from nucleus] evidence: NAS
GeneID:3553 -> Biological process: GO:0050796 [regulation of insulin secretion] evidence: IDA
GeneID:3553 -> Biological process: GO:0050995 [negative regulation of lipid catabolic process] evidence: IDA
GeneID:3553 -> Biological process: GO:0050996 [positive regulation of lipid catabolic process] evidence: ISS
GeneID:3553 -> Biological process: GO:0051044 [positive regulation of membrane protein ectodomain proteolysis] evidence: IDA
GeneID:3553 -> Biological process: GO:0051091 [positive regulation of sequence-specific DNA binding transcription factor activity] evidence: IDA
GeneID:3553 -> Biological process: GO:0051092 [positive regulation of NF-kappaB transcription factor activity] evidence: IDA
GeneID:3553 -> Biological process: GO:0051781 [positive regulation of cell division] evidence: IEA
GeneID:3553 -> Biological process: GO:0060355 [positive regulation of cell adhesion molecule production] evidence: NAS
GeneID:3553 -> Biological process: GO:0060559 [positive regulation of calcidiol 1-monooxygenase activity] evidence: IDA
GeneID:3553 -> Biological process: GO:0070164 [negative regulation of adiponectin secretion] evidence: ISS
GeneID:3553 -> Biological process: GO:0070487 [monocyte aggregation] evidence: IDA
GeneID:3553 -> Biological process: GO:0071260 [cellular response to mechanical stimulus] evidence: IEP
GeneID:3553 -> Biological process: GO:0071310 [cellular response to organic substance] evidence: IDA
GeneID:3553 -> Biological process: GO:0071407 [cellular response to organic cyclic compound] evidence: IDA
GeneID:3553 -> Biological process: GO:0071639 [positive regulation of monocyte chemotactic protein-1 production] evidence: IDA
GeneID:3553 -> Biological process: GO:2001240 [negative regulation of extrinsic apoptotic signaling pathway in absence of ligand] evidence: IDA
GeneID:3553 -> Cellular component: GO:0005576 [extracellular region] evidence: IDA
GeneID:3553 -> Cellular component: GO:0005576 [extracellular region] evidence: NAS
GeneID:3553 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS
GeneID:3553 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA
GeneID:3553 -> Cellular component: GO:0005615 [extracellular space] evidence: IMP
GeneID:3553 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:3553 -> Cellular component: GO:0030141 [secretory granule] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.