LOCUS       NM_001180837             384 bp    mRNA    linear   PLN 17-DEC-2024
DEFINITION  Saccharomyces cerevisiae S288C ubiquinol--cytochrome-c reductase
            subunit 7 (QCR7), partial mRNA.
ACCESSION   NM_001180837
VERSION     NM_001180837.1
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 384)
  AUTHORS   Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
            Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
            Weng,S. and Cherry,J.M.
  TITLE     New data and collaborations at the Saccharomyces Genome Database:
            updated reference genome, alleles, and the Alliance of Genome
            Resources
  JOURNAL   Genetics 220 (4) (2022)
   PUBMED   34897464
REFERENCE   2  (bases 1 to 384)
  AUTHORS   Jacq,C., Alt-Morbe,J., Andre,B., Arnold,W., Bahr,A., Ballesta,J.P.,
            Bargues,M., Baron,L., Becker,A., Biteau,N., Blocker,H., Blugeon,C.,
            Boskovic,J., Brandt,P., Bruckner,M., Buitrago,M.J., Coster,F.,
            Delaveau,T., del Rey,F., Dujon,B., Eide,L.G.,
            Garcia-Cantalejo,J.M., Goffeau,A., Gomez-Peris,A., Zaccaria,P. et
            al.
  TITLE     The nucleotide sequence of Saccharomyces cerevisiae chromosome IV
  JOURNAL   Nature 387 (6632 SUPPL), 75-78 (1997)
   PUBMED   9169867
REFERENCE   3  (bases 1 to 384)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   4  (bases 1 to 384)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (17-DEC-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 384)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2015) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   6  (bases 1 to 384)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2013) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   7  (bases 1 to 384)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2012) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   8  (bases 1 to 384)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2011) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   9  (bases 1 to 384)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (11-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001136).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-4-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..384
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="IV"
     gene            <1..>384
                     /gene="QCR7"
                     /locus_tag="YDR529C"
                     /gene_synonym="COR4; CRO1; UCR7"
                     /db_xref="GeneID:852142"
     CDS             1..384
                     /gene="QCR7"
                     /locus_tag="YDR529C"
                     /gene_synonym="COR4; CRO1; UCR7"
                     /experiment="EXISTENCE:direct assay:GO:0005739
                     mitochondrion [PMID:24769239|PMID:16823961]"
                     /experiment="EXISTENCE:direct assay:GO:0045275 respiratory
                     chain complex III [PMID:10873857]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0006122
                     mitochondrial electron transport, ubiquinol to cytochrome
                     c [PMID:2540976]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0008121
                     ubiquinol-cytochrome-c reductase activity [PMID:2540976]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0009060 aerobic
                     respiration [PMID:2540976]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0034551
                     mitochondrial respiratory chain complex III assembly
                     [PMID:11556808]"
                     /note="Subunit 7 of ubiquinol cytochrome-c reductase
                     (Complex III); Complex III is a component of the
                     mitochondrial inner membrane electron transport chain;
                     oriented facing the mitochondrial matrix; N-terminus
                     appears to play a role in complex assembly"
                     /codon_start=1
                     /product="ubiquinol--cytochrome-c reductase subunit 7"
                     /protein_id="NP_010818.1"
                     /db_xref="GeneID:852142"
                     /db_xref="SGD:S000002937"
                     /translation="

MPQSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKKLGLKFDDLIAEENPIMQTALRRLPEDESYARAYRIIRAHQTELTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDELDNIEVSK"

     misc_feature    55..354
                     /gene="QCR7"
                     /locus_tag="YDR529C"
                     /gene_synonym="COR4; CRO1; UCR7"
                     /note="Ubiquinol-cytochrome C reductase complex 14kD
                     subunit; Region: UCR_14kD; pfam02271"
                     /db_xref="CDD:460519"
ORIGIN      

atgccacagtcttttacgtctattgcgagaattggtgactatattttgaagtcacccgtcctctccaagttatgtgttccagttgccaatcagttcattaacctcgcaggttacaagaagttagggctcaaatttgacgacttaattgcagaggaaaatcccatcatgcagaccgctttaagaagactccctgaagatgaatcttatgccagagcatatagaataatcagggctcatcaaaccgagttgactcatcatttactgccaagaaacgaatggatcaaagcccaagaggatgttccttacctgttgccatacatattagaagctgaagctgcagctaaggagaaggacgagttagacaacatagaggtctccaaatga

//