LOCUS       NM_001179997             870 bp    mRNA    linear   PLN 17-DEC-2024
DEFINITION  Saccharomyces cerevisiae S288C Rrt5p (RRT5), partial mRNA.
ACCESSION   NM_001179997
VERSION     NM_001179997.1
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 870)
  AUTHORS   Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
            Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
            Weng,S. and Cherry,J.M.
  TITLE     New data and collaborations at the Saccharomyces Genome Database:
            updated reference genome, alleles, and the Alliance of Genome
            Resources
  JOURNAL   Genetics 220 (4) (2022)
   PUBMED   34897464
REFERENCE   2  (bases 1 to 870)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   3  (bases 1 to 870)
  AUTHORS   Murakami,Y., Naitou,M., Hagiwara,H., Shibata,T., Ozawa,M.,
            Sasanuma,S., Sasanuma,M., Tsuchiya,Y., Soeda,E., Yokoyama,K. et al.
  TITLE     Analysis of the nucleotide sequence of chromosome VI from
            Saccharomyces cerevisiae
  JOURNAL   Nat. Genet. 10 (3), 261-268 (1995)
   PUBMED   7670463
REFERENCE   4  (bases 1 to 870)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (17-DEC-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 870)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2015) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   6  (bases 1 to 870)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2012) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   7  (bases 1 to 870)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2011) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   8  (bases 1 to 870)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (11-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001138).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-4-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..870
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="VI"
     gene            <1..>870
                     /gene="RRT5"
                     /locus_tag="YFR032C"
                     /db_xref="GeneID:850591"
     CDS             1..870
                     /gene="RRT5"
                     /locus_tag="YFR032C"
                     /experiment="EXISTENCE:direct assay:GO:0005628 prospore
                     membrane [PMID:24390141]"
                     /note="hypothetical protein; non-essential gene identified
                     in a screen for mutants with increased levels of rDNA
                     transcription; expressed at high levels during
                     sporulation"
                     /codon_start=1
                     /product="Rrt5p"
                     /protein_id="NP_116689.1"
                     /db_xref="GeneID:850591"
                     /db_xref="SGD:S000001928"
                     /translation="

MTEQVNNDTTSDTTTTITTVYISNLPFTASERDLHAFLNNYGASSVLIPTQTVRRFSKRHNSNPRKPLGIAFAQFANNTLALKAIQDLNGTVFQNQKLFLKLHVPYEADSTPDTDVKKPKEKNKVKKTPETAADTVYCHDLPDDITDSEIRELFQLYSPQEIWIYRSKVYRRKCIPFAPHQITAALVTLQSETPIGDICDSVAKTATLRGKSIIVKPAYVSKIQEIKQLVKDNLTNARDPPPAALAEPAPAPAPVEPAEQVQEGQDNAETNDVPPPPASSSDRPTVAAT"

     misc_feature    58..318
                     /gene="RRT5"
                     /locus_tag="YFR032C"
                     /note="RNA recognition motif 1 (RRM1) found in yeast
                     regulator of rDNA transcription protein 5 (RRT5) and
                     similar proteins; Region: RRM1_RRT5; cd12409"
                     /db_xref="CDD:409843"
     misc_feature    394..678
                     /gene="RRT5"
                     /locus_tag="YFR032C"
                     /note="RNA recognition motif 2 (RRM2) found in yeast
                     regulator of rDNA transcription protein 5 (RRT5) and
                     similar proteins; Region: RRM2_RRT5; cd12410"
                     /db_xref="CDD:409844"
ORIGIN      

atgacagaacaagttaacaatgacactaccagtgacactaccactaccattaccacagtttacatttcgaacctgccattcacggcgagtgagcgagacctacatgccttcctaaacaactatggcgccagttcagtgttgattccaacgcagaccgtccgcagattcagcaaaaggcacaatagcaaccctcgcaaaccactaggcatagcatttgcccagttcgcaaacaatactctggctttgaaggccattcaagacttgaacggaaccgttttccaaaatcagaaactatttctaaagttacacgttccttacgaggcagactctactccagacacggatgtaaagaagcccaaagaaaaaaataaggttaagaagacaccagagactgccgcggatacggtttactgtcacgacctgccagacgatataaccgacagtgagatccgtgagttgttccagctctactcgcctcaagaaatctggatttacaggtccaaggtgtacaggagaaagtgtattccttttgctccacaccaaattactgccgctttggtcactttgcaatctgaaaccccaattggggacatttgtgacagtgtggccaagacagctactttgaggggcaaatcgataatagtgaagcccgcttacgtctctaagattcaagaaattaaacaattggtcaaggacaacttaaccaatgcgcgcgacccacctccagcagcattggcagagccagcgccagcgccagcgccagtagagccagcggagcaagtgcaggaagggcaagacaatgcggaaaccaatgatgtcccacctccgcctgcttcgtcttccgatcgtccaaccgtggctgctacttag

//