LOCUS       NM_001179946             369 bp    mRNA    linear   PLN 17-DEC-2024
DEFINITION  Saccharomyces cerevisiae S288C seripauperin PAU5 (PAU5), partial
            mRNA.
ACCESSION   NM_001179946
VERSION     NM_001179946.1
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 369)
  AUTHORS   Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
            Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
            Weng,S. and Cherry,J.M.
  TITLE     New data and collaborations at the Saccharomyces Genome Database:
            updated reference genome, alleles, and the Alliance of Genome
            Resources
  JOURNAL   Genetics 220 (4) (2022)
   PUBMED   34897464
REFERENCE   2  (bases 1 to 369)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   3  (bases 1 to 369)
  AUTHORS   Murakami,Y., Naitou,M., Hagiwara,H., Shibata,T., Ozawa,M.,
            Sasanuma,S., Sasanuma,M., Tsuchiya,Y., Soeda,E., Yokoyama,K. et al.
  TITLE     Analysis of the nucleotide sequence of chromosome VI from
            Saccharomyces cerevisiae
  JOURNAL   Nat. Genet. 10 (3), 261-268 (1995)
   PUBMED   7670463
REFERENCE   4  (bases 1 to 369)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (17-DEC-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 369)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2015) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   6  (bases 1 to 369)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2012) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   7  (bases 1 to 369)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2011) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   8  (bases 1 to 369)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (11-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001138).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-4-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..369
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="VI"
     gene            <1..>369
                     /gene="PAU5"
                     /locus_tag="YFL020C"
                     /db_xref="GeneID:850524"
     CDS             1..369
                     /gene="PAU5"
                     /locus_tag="YFL020C"
                     /experiment="EXISTENCE:direct assay:GO:0000324 fungal-type
                     vacuole [PMID:26928762]"
                     /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
                     [PMID:18312373]"
                     /experiment="EXISTENCE:direct assay:GO:0016020 membrane
                     [PMID:18312373]"
                     /note="Member of the seripauperin multigene family;
                     encoded mainly in subtelomeric regions; induced during
                     alcoholic fermentation; induced by low temperature and
                     also by anaerobic conditions; negatively regulated by
                     oxygen and repressed by heme"
                     /codon_start=1
                     /product="seripauperin PAU5"
                     /protein_id="NP_116633.1"
                     /db_xref="GeneID:850524"
                     /db_xref="SGD:S000001874"
                     /translation="

MVKLTSIAAGVAAIAAGASAAATTTLSQSDERVNLVELGVYVSDIRAHLAEYYSFQAAHPTETYPVEIAEAVFNYGDFTTMLTGIPADQVTRVITGVPWYSSRLKPAISSALSADGIYTIAN"

     misc_feature    73..351
                     /gene="PAU5"
                     /locus_tag="YFL020C"
                     /note="Seripauperin and TIP1 family; Region: SRP1_TIP1;
                     pfam00660"
                     /db_xref="CDD:395534"
ORIGIN      

atggtcaaattaacttcaatcgccgctggtgtcgccgccattgccgctggtgcctccgctgcagcaaccactacactatctcaatctgacgaaagagttaatttggttgaattaggtgtctatgtttccgatatcagagctcatttggctgaatactactccttccaagctgcccacccaactgaaacttatccagttgaaattgcagaagctgttttcaactacggtgatttcaccaccatgttgactggtattcccgccgaccaagttaccagagttatcactggtgttccatggtactctagcagattaaagccagctatctctagcgctctatccgcagacggtatctacactattgcaaattag

//