2025-04-17 01:58:34, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001179435 474 bp mRNA linear PLN 17-DEC-2024 DEFINITION Saccharomyces cerevisiae S288C Aim19p (AIM19), partial mRNA. ACCESSION NM_001179435 VERSION NM_001179435.3 DBLINK BioProject: PRJNA128 KEYWORDS RefSeq. SOURCE Saccharomyces cerevisiae S288C ORGANISM Saccharomyces cerevisiae S288C Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 474) AUTHORS Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M., Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S., Weng,S. and Cherry,J.M. TITLE New data and collaborations at the Saccharomyces Genome Database: updated reference genome, alleles, and the Alliance of Genome Resources JOURNAL Genetics 220 (4) (2022) PUBMED 34897464 REFERENCE 2 (bases 1 to 474) AUTHORS Churcher,C., Bowman,S., Badcock,K., Bankier,A., Brown,D., Chillingworth,T., Connor,R., Devlin,K., Gentles,S., Hamlin,N., Harris,D., Horsnell,T., Hunt,S., Jagels,K., Jones,M., Lye,G., Moule,S., Odell,C., Pearson,D., Rajandream,M., Rice,P., Rowley,N., Skelton,J., Smith,V., Barrell,B. et al. TITLE The nucleotide sequence of Saccharomyces cerevisiae chromosome IX JOURNAL Nature 387 (6632 SUPPL), 84-87 (1997) PUBMED 9169870 REFERENCE 3 (bases 1 to 474) AUTHORS Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B., Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M., Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and Oliver,S.G. TITLE Life with 6000 genes JOURNAL Science 274 (5287), 546 (1996) PUBMED 8849441 REFERENCE 4 (bases 1 to 474) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (17-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 474) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (04-MAY-2012) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 6 (bases 1 to 474) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (31-MAR-2011) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Sequence update by submitter REFERENCE 7 (bases 1 to 474) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (14-DEC-2009) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA COMMENT REVIEWED REFSEQ: This record has been curated by SGD. This record is derived from an annotated genomic sequence (NC_001141). On Jul 30, 2012 this sequence version replaced NM_001179435.2. ##Genome-Annotation-Data-START## Annotation Provider :: SGD Annotation Status :: Full Annotation Annotation Version :: R64-4-1 URL :: http://www.yeastgenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..474 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="IX" gene <1..>474 /gene="AIM19" /locus_tag="YIL087C" /db_xref="GeneID:854722" CDS 1..474 /gene="AIM19" /locus_tag="YIL087C" /experiment="EXISTENCE:direct assay:GO:0005739 mitochondrion [PMID:14562095|PMID:16823961|PMID:24769239|PMID:14576278]" /experiment="EXISTENCE:physical interaction:GO:0005739 mitochondrion [PMID:25124039]" /note="hypothetical protein; mitochondrial protein that physically interacts with Tim23p; null mutant displays reduced respiratory growth" /codon_start=1 /product="Aim19p" /protein_id="NP_012179.3" /db_xref="GeneID:854722" /db_xref="SGD:S000001349" /translation="
MSAKPATDDAKDELLSPFRRLYALTRTPYPALANAALLASTPVLSPSFKVPPTQSPALSIPMSRVFSKSSTARIGITTKTALFFSTMQAIGAYMIYDNDLENGAGFIATWSALYLIVGGKKSFSALRYGRTWPLVLSSVSLANAVLYGQRFLATGFQ"
misc_feature 124..456 /gene="AIM19" /locus_tag="YIL087C" /note="Altered inheritance of mitochondria protein 19; Region: Aim19; pfam10315" /db_xref="CDD:402092" ORIGIN
atgtctgctaaacccgctactgacgatgccaaagatgaacttctatcaccatttcgccggctatatgcattgacaaggacaccttatcctgcgctcgcaaacgcagcactattagcatccactccggtgctatccccaagctttaaagtgcctccaacgcaatctcctgccctctcgataccaatgtctagggtattctctaaatcttctactgccagaatcggtataactactaaaaccgcccttttcttttctacaatgcaagctataggtgcatacatgatctatgacaacgacttggaaaatggggctggcttcattgctacatggtccgccttatatttgattgtagggggcaagaagtcctttagtgcgttaagatatggaagaacttggccgttggtgctatcctcggtttcattggccaacgcagtcctttatggccaacggttccttgctaccggattccagtga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]