LOCUS       NM_001179435             474 bp    mRNA    linear   PLN 17-DEC-2024
DEFINITION  Saccharomyces cerevisiae S288C Aim19p (AIM19), partial mRNA.
ACCESSION   NM_001179435
VERSION     NM_001179435.3
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 474)
  AUTHORS   Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
            Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
            Weng,S. and Cherry,J.M.
  TITLE     New data and collaborations at the Saccharomyces Genome Database:
            updated reference genome, alleles, and the Alliance of Genome
            Resources
  JOURNAL   Genetics 220 (4) (2022)
   PUBMED   34897464
REFERENCE   2  (bases 1 to 474)
  AUTHORS   Churcher,C., Bowman,S., Badcock,K., Bankier,A., Brown,D.,
            Chillingworth,T., Connor,R., Devlin,K., Gentles,S., Hamlin,N.,
            Harris,D., Horsnell,T., Hunt,S., Jagels,K., Jones,M., Lye,G.,
            Moule,S., Odell,C., Pearson,D., Rajandream,M., Rice,P., Rowley,N.,
            Skelton,J., Smith,V., Barrell,B. et al.
  TITLE     The nucleotide sequence of Saccharomyces cerevisiae chromosome IX
  JOURNAL   Nature 387 (6632 SUPPL), 84-87 (1997)
   PUBMED   9169870
REFERENCE   3  (bases 1 to 474)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   4  (bases 1 to 474)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (17-DEC-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 474)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2012) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   6  (bases 1 to 474)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2011) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   7  (bases 1 to 474)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (14-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001141).
            
            On Jul 30, 2012 this sequence version replaced NM_001179435.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-4-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..474
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="IX"
     gene            <1..>474
                     /gene="AIM19"
                     /locus_tag="YIL087C"
                     /db_xref="GeneID:854722"
     CDS             1..474
                     /gene="AIM19"
                     /locus_tag="YIL087C"
                     /experiment="EXISTENCE:direct assay:GO:0005739
                     mitochondrion
                     [PMID:14562095|PMID:16823961|PMID:24769239|PMID:14576278]"
                     /experiment="EXISTENCE:physical interaction:GO:0005739
                     mitochondrion [PMID:25124039]"
                     /note="hypothetical protein; mitochondrial protein that
                     physically interacts with Tim23p; null mutant displays
                     reduced respiratory growth"
                     /codon_start=1
                     /product="Aim19p"
                     /protein_id="NP_012179.3"
                     /db_xref="GeneID:854722"
                     /db_xref="SGD:S000001349"
                     /translation="

MSAKPATDDAKDELLSPFRRLYALTRTPYPALANAALLASTPVLSPSFKVPPTQSPALSIPMSRVFSKSSTARIGITTKTALFFSTMQAIGAYMIYDNDLENGAGFIATWSALYLIVGGKKSFSALRYGRTWPLVLSSVSLANAVLYGQRFLATGFQ"

     misc_feature    124..456
                     /gene="AIM19"
                     /locus_tag="YIL087C"
                     /note="Altered inheritance of mitochondria protein 19;
                     Region: Aim19; pfam10315"
                     /db_xref="CDD:402092"
ORIGIN      

atgtctgctaaacccgctactgacgatgccaaagatgaacttctatcaccatttcgccggctatatgcattgacaaggacaccttatcctgcgctcgcaaacgcagcactattagcatccactccggtgctatccccaagctttaaagtgcctccaacgcaatctcctgccctctcgataccaatgtctagggtattctctaaatcttctactgccagaatcggtataactactaaaaccgcccttttcttttctacaatgcaagctataggtgcatacatgatctatgacaacgacttggaaaatggggctggcttcattgctacatggtccgccttatatttgattgtagggggcaagaagtcctttagtgcgttaagatatggaagaacttggccgttggtgctatcctcggtttcattggccaacgcagtcctttatggccaacggttccttgctaccggattccagtga

//