2025-04-17 02:08:31, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001179419 408 bp mRNA linear PLN 17-DEC-2024 DEFINITION Saccharomyces cerevisiae S288C ribosomal 40S subunit protein S24B (RPS24B), partial mRNA. ACCESSION NM_001179419 VERSION NM_001179419.1 DBLINK BioProject: PRJNA128 KEYWORDS RefSeq. SOURCE Saccharomyces cerevisiae S288C ORGANISM Saccharomyces cerevisiae S288C Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 408) AUTHORS Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M., Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S., Weng,S. and Cherry,J.M. TITLE New data and collaborations at the Saccharomyces Genome Database: updated reference genome, alleles, and the Alliance of Genome Resources JOURNAL Genetics 220 (4) (2022) PUBMED 34897464 REFERENCE 2 (bases 1 to 408) AUTHORS Churcher,C., Bowman,S., Badcock,K., Bankier,A., Brown,D., Chillingworth,T., Connor,R., Devlin,K., Gentles,S., Hamlin,N., Harris,D., Horsnell,T., Hunt,S., Jagels,K., Jones,M., Lye,G., Moule,S., Odell,C., Pearson,D., Rajandream,M., Rice,P., Rowley,N., Skelton,J., Smith,V., Barrell,B. et al. TITLE The nucleotide sequence of Saccharomyces cerevisiae chromosome IX JOURNAL Nature 387 (6632 SUPPL), 84-87 (1997) PUBMED 9169870 REFERENCE 3 (bases 1 to 408) AUTHORS Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B., Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M., Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and Oliver,S.G. TITLE Life with 6000 genes JOURNAL Science 274 (5287), 546 (1996) PUBMED 8849441 REFERENCE 4 (bases 1 to 408) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (17-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 408) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (04-MAY-2012) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 6 (bases 1 to 408) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (31-MAR-2011) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Sequence update by submitter REFERENCE 7 (bases 1 to 408) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (14-DEC-2009) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA COMMENT REVIEWED REFSEQ: This record has been curated by SGD. This record is derived from an annotated genomic sequence (NC_001141). ##Genome-Annotation-Data-START## Annotation Provider :: SGD Annotation Status :: Full Annotation Annotation Version :: R64-4-1 URL :: http://www.yeastgenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..408 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="IX" gene <1..>408 /gene="RPS24B" /locus_tag="YIL069C" /gene_synonym="RPS24EB" /db_xref="GeneID:854741" CDS 1..408 /gene="RPS24B" /locus_tag="YIL069C" /gene_synonym="RPS24EB" /experiment="EXISTENCE:genetic interaction:GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [PMID:16246728]" /note="Protein component of the small (40S) ribosomal subunit; homologous to mammalian ribosomal protein S24, no bacterial homolog; RPS24B has a paralog, RPS24A, that arose from the whole genome duplication" /codon_start=1 /product="ribosomal 40S subunit protein S24B" /protein_id="NP_012195.1" /db_xref="GeneID:854741" /db_xref="SGD:S000001331" /translation="
MSDAVTIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEVYKAEKDAVSVFGFRTQFGGGKSVGFGLVYNSVAEAKKFEPTYRLVRYGLAEKVEKASRQQRKQKKNRDKKIFGTGKRLAKKVARRNAD"
misc_feature 1..369 /gene="RPS24B" /locus_tag="YIL069C" /gene_synonym="RPS24EB" /note="40S ribosomal protein S24; Provisional; Region: PTZ00071" /db_xref="CDD:240256" ORIGIN
atgtctgacgctgtcactattcgtaccagaaaggttatctccaacccattgttggccagaaagcaattcgttgttgacgtcttgcacccaaacagagctaatgtctccaaggatgaattacgtgaaaaattagctgaagtctacaaggctgaaaaggacgctgtctccgttttcggtttcagaacccaatttggtggtggtaaatctgttggtttcggtttggtctacaactctgttgccgaagctaagaagttcgaaccaacttacagattagtcagatacggtttggctgaaaaggttgaaaaggcttccagacaacaaagaaagcaaaagaagaacagagacaagaagatctttggtactggtaaaagattggccaaaaaggttgctcgtcgtaacgctgattaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]