LOCUS       NM_001178753             633 bp    mRNA    linear   PLN 17-DEC-2024
DEFINITION  Saccharomyces cerevisiae S288C homeodomain mating type protein
            alpha2 (MATALPHA2), partial mRNA.
ACCESSION   NM_001178753
VERSION     NM_001178753.1
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 633)
  AUTHORS   Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
            Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
            Weng,S. and Cherry,J.M.
  TITLE     New data and collaborations at the Saccharomyces Genome Database:
            updated reference genome, alleles, and the Alliance of Genome
            Resources
  JOURNAL   Genetics 220 (4) (2022)
   PUBMED   34897464
REFERENCE   2  (bases 1 to 633)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   3  (bases 1 to 633)
  AUTHORS   Oliver,S.G., van der Aart,Q.J., Agostoni-Carbone,M.L., Aigle,M.,
            Alberghina,L., Alexandraki,D., Antoine,G., Anwar,R., Ballesta,J.P.,
            Benit,P. et al.
  TITLE     The complete DNA sequence of yeast chromosome III
  JOURNAL   Nature 357 (6373), 38-46 (1992)
   PUBMED   1574125
REFERENCE   4  (bases 1 to 633)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (17-DEC-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 633)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2015) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   6  (bases 1 to 633)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (12-APR-2011) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   7  (bases 1 to 633)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (27-MAY-2010) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   8  (bases 1 to 633)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAY-2010) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   9  (bases 1 to 633)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (11-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001135).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-4-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..633
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="III"
     gene            <1..>633
                     /gene="MATALPHA2"
                     /locus_tag="YCR039C"
                     /gene_synonym="ALPHA2"
                     /db_xref="GeneID:850406"
     CDS             1..633
                     /gene="MATALPHA2"
                     /locus_tag="YCR039C"
                     /gene_synonym="ALPHA2"
                     /experiment="EXISTENCE:direct assay:GO:0000122 negative
                     regulation of transcription by RNA polymerase II
                     [PMID:3893743]"
                     /experiment="EXISTENCE:direct assay:GO:0001227 DNA-binding
                     transcription repressor activity, RNA polymerase
                     II-specific [PMID:15598821]"
                     /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
                     [PMID:1976249]"
                     /experiment="EXISTENCE:direct assay:GO:0008301 DNA
                     binding, bending [PMID:7569974|PMID:7739902]"
                     /experiment="EXISTENCE:direct assay:GO:0043565
                     sequence-specific DNA binding [PMID:3893743]"
                     /note="Homeobox-domain protein; with Mcm1p, represses
                     a-specific genes in haploids; acts with A1p to repress
                     transcription of haploid-specific genes in diploids; one
                     of two genes encoded by the MATalpha mating type cassette"
                     /codon_start=1
                     /product="homeodomain mating type protein alpha2"
                     /protein_id="NP_009868.3"
                     /db_xref="GeneID:850406"
                     /db_xref="SGD:S000000635"
                     /translation="

MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE"

     misc_feature    order(394..402,406..408,466..468,484..486,523..525,
                     529..534,541..546,550..558,562..564)
                     /gene="MATALPHA2"
                     /locus_tag="YCR039C"
                     /gene_synonym="ALPHA2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(394..396,403..405,532..534,541..546,553..555)
                     /gene="MATALPHA2"
                     /locus_tag="YCR039C"
                     /gene_synonym="ALPHA2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    403..564
                     /gene="MATALPHA2"
                     /locus_tag="YCR039C"
                     /gene_synonym="ALPHA2"
                     /note="Homeodomain; Region: HOX; smart00389"
                     /db_xref="CDD:197696"
ORIGIN      

atgaataaaatacccattaaagaccttttaaatccacaaatcacagatgagtttaaatccagcatactagacataaataaaaagctcttttctatttgctgtaatttacctaagttaccagagagtgtaacaacagaagaagaagttgaattaagggatatattaggattcttatctagggccaacaaaaaccgtaagattagtgatgaggagaagaagttgttgcaaacaacatctcaactcactactaccattactgtattactcaaagaaatgcgcagcatagaaaacgatagaagtaattatcaacttacacagaaaaataaatcggcggatgggttggtatttaatgtggtaactcaagatatgataaacaaaagtactaaaccttacagaggacaccggtttacaaaagaaaatgtccgaatactagaaagttggtttgcaaagaacatcgagaacccatatctagataccaagggcctagagaatctaatgaagaataccagtttatctcgcattcaaatcaaaaactgggtttcgaatagaagaagaaaagaaaaaacaataacaatcgctccagaattagcggacctcttgagcggtgagcctctggcaaagaagaaagaatga

//