GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-01 08:16:29, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       NM_024160                698 bp    mRNA    linear   ROD 30-MAR-2024
DEFINITION  Rattus norvegicus cytochrome b-245 alpha chain (Cyba), mRNA.
ACCESSION   NM_024160
VERSION     NM_024160.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 698)
  AUTHORS   Ichikawa,R., Masuda,S., Nakahara,J., Kobayashi,M., Yamashita,R.,
            Uomoto,S., Kanami,O., Hara,E., Ito,Y., Shibutani,M. and Yoshida,T.
  TITLE     Inhibition of autophagy with expression of NADPH oxidase subunit
            p22phox in preneoplastic lesions in a high-fat diet and
            streptozotocin-related hepatocarcinogenesis rat model
  JOURNAL   J Toxicol Sci 47 (7), 289-300 (2022)
   PUBMED   35786680
  REMARK    GeneRIF: Inhibition of autophagy with expression of NADPH oxidase
            subunit p22phox in preneoplastic lesions in a high-fat diet and
            streptozotocin-related hepatocarcinogenesis rat model.
REFERENCE   2  (bases 1 to 698)
  AUTHORS   Tang,Y., Huang,Q., Liu,C., Ou,H., Huang,D., Peng,F., Liu,C. and
            Mo,Z.
  TITLE     p22phox promotes Ang-II-induced vascular smooth muscle cell
            phenotypic switch by regulating KLF4 expression
  JOURNAL   Biochem Biophys Res Commun 514 (1), 280-286 (2019)
   PUBMED   31030942
  REMARK    GeneRIF: The role of p22phox in the Angiotensin-II -induced
            proliferation and migration of the vascular smooth muscle cells via
            the H2O2-ERK1/2/AKT-KLF4 signaling pathway.
REFERENCE   3  (bases 1 to 698)
  AUTHORS   Naito,Y., Sawada,H., Oboshi,M., Okuno,K., Yasumura,S., Okuhara,Y.,
            Eguchi,A., Nishimura,K., Soyama,Y., Asakura,M., Ishihara,M.,
            Tsujino,T. and Masuyama,T.
  TITLE     Altered expression of intestinal duodenal cytochrome b and divalent
            metal transporter 1 might be associated with cardio-renal anemia
            syndrome
  JOURNAL   Heart Vessels 32 (11), 1410-1414 (2017)
   PUBMED   28669019
  REMARK    GeneRIF: impaired intestinal expression of Dcyt-b and DMT-1 might
            be associated with the reduction of an iron uptake in CKD. Taken
            together, impaired these intestinal iron transporters may become a
            novel therapeutic target for cardio-renal anemia syndrome.
REFERENCE   4  (bases 1 to 698)
  AUTHORS   Thomas,D.C., Clare,S., Sowerby,J.M., Pardo,M., Juss,J.K.,
            Goulding,D.A., van der Weyden,L., Storisteanu,D., Prakash,A.,
            Espeli,M., Flint,S., Lee,J.C., Hoenderdos,K., Kane,L., Harcourt,K.,
            Mukhopadhyay,S., Umrania,Y., Antrobus,R., Nathan,J.A., Adams,D.J.,
            Bateman,A., Choudhary,J.S., Lyons,P.A., Condliffe,A.M.,
            Chilvers,E.R., Dougan,G. and Smith,K.G.
  TITLE     Eros is a novel transmembrane protein that controls the phagocyte
            respiratory burst and is essential for innate immunity
  JOURNAL   J Exp Med 214 (4), 1111-1128 (2017)
   PUBMED   28351984
REFERENCE   5  (bases 1 to 698)
  AUTHORS   Zahid,H.M., Ferdaus,M.Z., Ohara,H., Isomura,M. and Nabika,T.
  TITLE     Effect of p22phox depletion on sympathetic regulation of blood
            pressure in SHRSP: evaluation in a new congenic strain
  JOURNAL   Sci Rep 6, 36739 (2016)
   PUBMED   27824157
  REMARK    GeneRIF: p22phox has a role in sympathetic regulation of blood
            pressure in stroke-prone spontaneously hypertensive rats
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 698)
  AUTHORS   Fukui,T., Lassegue,B., Kai,H., Alexander,R.W. and Griendling,K.K.
  TITLE     Cytochrome b-558 alpha-subunit cloning and expression in rat aortic
            smooth muscle cells
  JOURNAL   Biochim Biophys Acta 1231 (3), 215-219 (1995)
   PUBMED   7578211
REFERENCE   7  (bases 1 to 698)
  AUTHORS   de Boer,M., de Klein,A., Hossle,J.P., Seger,R., Corbeel,L.,
            Weening,R.S. and Roos,D.
  TITLE     Cytochrome b558-negative, autosomal recessive chronic granulomatous
            disease: two new mutations in the cytochrome b558 light chain of
            the NADPH oxidase (p22-phox)
  JOURNAL   Am J Hum Genet 51 (5), 1127-1135 (1992)
   PUBMED   1415254
REFERENCE   8  (bases 1 to 698)
  AUTHORS   Dinauer,M.C., Pierce,E.A., Erickson,R.W., Muhlebach,T.J.,
            Messner,H., Orkin,S.H., Seger,R.A. and Curnutte,J.T.
  TITLE     Point mutation in the cytoplasmic domain of the neutrophil p22-phox
            cytochrome b subunit is associated with a nonfunctional NADPH
            oxidase and chronic granulomatous disease
  JOURNAL   Proc Natl Acad Sci U S A 88 (24), 11231-11235 (1991)
   PUBMED   1763037
REFERENCE   9  (bases 1 to 698)
  AUTHORS   Dinauer,M.C., Pierce,E.A., Bruns,G.A., Curnutte,J.T. and Orkin,S.H.
  TITLE     Human neutrophil cytochrome b light chain (p22-phox). Gene
            structure, chromosomal location, and mutations in
            cytochrome-negative autosomal recessive chronic granulomatous
            disease
  JOURNAL   J Clin Invest 86 (5), 1729-1737 (1990)
   PUBMED   2243141
REFERENCE   10 (bases 1 to 698)
  AUTHORS   Parkos,C.A., Allen,R.A., Cochrane,C.G. and Jesaitis,A.J.
  TITLE     Purified cytochrome b from human granulocyte plasma membrane is
            comprised of two polypeptides with relative molecular weights of
            91,000 and 22,000
  JOURNAL   J Clin Invest 80 (3), 732-742 (1987)
   PUBMED   3305576
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAXUCZ010000019.1.
            
            On Dec 2, 2020 this sequence version replaced NM_024160.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U18729.1, AJ295951.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN16676784, SAMN16676789
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-91                JAXUCZ010000019.1  67404124-67404214   c
            92-161              JAXUCZ010000019.1  67399209-67399278   c
            162-236             JAXUCZ010000019.1  67398743-67398817   c
            237-320             JAXUCZ010000019.1  67398470-67398553   c
            321-402             JAXUCZ010000019.1  67397558-67397639   c
            403-698             JAXUCZ010000019.1  67396143-67396438   c
FEATURES             Location/Qualifiers
     source          1..698
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="19"
                     /map="19q12"
     gene            1..698
                     /gene="Cyba"
                     /gene_synonym="p22-phox; Phox"
                     /note="cytochrome b-245 alpha chain"
                     /db_xref="GeneID:79129"
                     /db_xref="RGD:620573"
     exon            1..91
                     /gene="Cyba"
                     /gene_synonym="p22-phox; Phox"
                     /inference="alignment:Splign:2.1.0"
     CDS             34..612
                     /gene="Cyba"
                     /gene_synonym="p22-phox; Phox"
                     /note="p22phox; p22 phagocyte B-cytochrome; cytochrome
                     b(558) alpha chain; cytochrome b558 subunit alpha;
                     neutrophil cytochrome b 22 kDa polypeptide;
                     superoxide-generating NADPH oxidase light chain subunit;
                     cytochrome b558 alpha-subunit; cytochrome b-245, alpha
                     polypeptide; alpha-subunit p22"
                     /codon_start=1
                     /product="cytochrome b-245 light chain"
                     /protein_id="NP_077074.1"
                     /db_xref="GeneID:79129"
                     /db_xref="RGD:620573"
                     /translation="
MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVLICLLEYPRGKRKKGSTMERCGQKYLTAVVKLFGPLTRNYYVRAVLHLLLSVPAGFLLATILGTVCLAIASVIYLLAAIRGEQWTPIEPKPKERPQVGGTIKQPPTNPPPRPPAEVRKKPSEAEEEAASAGGPQVNPIPVTDEVV"
     misc_feature    37..603
                     /gene="Cyba"
                     /gene_synonym="p22-phox; Phox"
                     /note="Cytochrome Cytochrome b558 alpha-subunit; Region:
                     Cytochrom_B558a; pfam05038"
                     /db_xref="CDD:461532"
     misc_feature    433..609
                     /gene="Cyba"
                     /gene_synonym="p22-phox; Phox"
                     /note="propagated from UniProtKB/Swiss-Prot (Q62737.3);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    472..474
                     /gene="Cyba"
                     /gene_synonym="p22-phox; Phox"
                     /note="Phosphothreonine.
                     /evidence=ECO:0000250|UniProtKB:P13498; propagated from
                     UniProtKB/Swiss-Prot (Q62737.3); phosphorylation site"
     misc_feature    535..537
                     /gene="Cyba"
                     /gene_synonym="p22-phox; Phox"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (Q62737.3); phosphorylation site"
     misc_feature    559..561
                     /gene="Cyba"
                     /gene_synonym="p22-phox; Phox"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (Q62737.3); phosphorylation site"
     exon            92..161
                     /gene="Cyba"
                     /gene_synonym="p22-phox; Phox"
                     /inference="alignment:Splign:2.1.0"
     exon            162..236
                     /gene="Cyba"
                     /gene_synonym="p22-phox; Phox"
                     /inference="alignment:Splign:2.1.0"
     exon            237..320
                     /gene="Cyba"
                     /gene_synonym="p22-phox; Phox"
                     /inference="alignment:Splign:2.1.0"
     exon            321..402
                     /gene="Cyba"
                     /gene_synonym="p22-phox; Phox"
                     /inference="alignment:Splign:2.1.0"
     exon            403..698
                     /gene="Cyba"
                     /gene_synonym="p22-phox; Phox"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ggaccgagcggctgcgtgtgctgggtcctcaccatggggcagatcgagtgggccatgtgggccaacgaacaggcgctggcatctggcctgatcctcatcacagggggcatcgtggctactgcgggacgcttcacgcagtggtactttggtgcttactctattgttgcaggagtgctcatctgtctgctggagtacccccggggaaagaggaaaaagggctccaccatggagcggtgtggacagaagtacctgaccgctgtggtgaagctgttcgggcccctcaccagaaattactacgtccgggctgtcctccacttactgctgtccgtgcctgcaggcttcctgctggccaccatcctggggaccgtctgcttggccattgccagtgtgatctacctgctggcagccatccggggtgagcagtggactcccattgagcctaaacccaaggagcggccgcaggttggaggcaccatcaagcagccacctaccaaccccccaccccggccaccagcggaggtccgcaagaagccaagtgaggccgaagaggaggcagcctcggcaggaggaccccaggttaacccaattccagtgacagatgaggtcgtgtgaccttcagtggctcctgcttgagtttccaaggtgttgctcccagagggtggtgatgcccactgtaataaacatggttaatagctggt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]