2024-11-01 08:16:29, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS NM_024160 698 bp mRNA linear ROD 30-MAR-2024 DEFINITION Rattus norvegicus cytochrome b-245 alpha chain (Cyba), mRNA. ACCESSION NM_024160 VERSION NM_024160.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 698) AUTHORS Ichikawa,R., Masuda,S., Nakahara,J., Kobayashi,M., Yamashita,R., Uomoto,S., Kanami,O., Hara,E., Ito,Y., Shibutani,M. and Yoshida,T. TITLE Inhibition of autophagy with expression of NADPH oxidase subunit p22phox in preneoplastic lesions in a high-fat diet and streptozotocin-related hepatocarcinogenesis rat model JOURNAL J Toxicol Sci 47 (7), 289-300 (2022) PUBMED 35786680 REMARK GeneRIF: Inhibition of autophagy with expression of NADPH oxidase subunit p22phox in preneoplastic lesions in a high-fat diet and streptozotocin-related hepatocarcinogenesis rat model. REFERENCE 2 (bases 1 to 698) AUTHORS Tang,Y., Huang,Q., Liu,C., Ou,H., Huang,D., Peng,F., Liu,C. and Mo,Z. TITLE p22phox promotes Ang-II-induced vascular smooth muscle cell phenotypic switch by regulating KLF4 expression JOURNAL Biochem Biophys Res Commun 514 (1), 280-286 (2019) PUBMED 31030942 REMARK GeneRIF: The role of p22phox in the Angiotensin-II -induced proliferation and migration of the vascular smooth muscle cells via the H2O2-ERK1/2/AKT-KLF4 signaling pathway. REFERENCE 3 (bases 1 to 698) AUTHORS Naito,Y., Sawada,H., Oboshi,M., Okuno,K., Yasumura,S., Okuhara,Y., Eguchi,A., Nishimura,K., Soyama,Y., Asakura,M., Ishihara,M., Tsujino,T. and Masuyama,T. TITLE Altered expression of intestinal duodenal cytochrome b and divalent metal transporter 1 might be associated with cardio-renal anemia syndrome JOURNAL Heart Vessels 32 (11), 1410-1414 (2017) PUBMED 28669019 REMARK GeneRIF: impaired intestinal expression of Dcyt-b and DMT-1 might be associated with the reduction of an iron uptake in CKD. Taken together, impaired these intestinal iron transporters may become a novel therapeutic target for cardio-renal anemia syndrome. REFERENCE 4 (bases 1 to 698) AUTHORS Thomas,D.C., Clare,S., Sowerby,J.M., Pardo,M., Juss,J.K., Goulding,D.A., van der Weyden,L., Storisteanu,D., Prakash,A., Espeli,M., Flint,S., Lee,J.C., Hoenderdos,K., Kane,L., Harcourt,K., Mukhopadhyay,S., Umrania,Y., Antrobus,R., Nathan,J.A., Adams,D.J., Bateman,A., Choudhary,J.S., Lyons,P.A., Condliffe,A.M., Chilvers,E.R., Dougan,G. and Smith,K.G. TITLE Eros is a novel transmembrane protein that controls the phagocyte respiratory burst and is essential for innate immunity JOURNAL J Exp Med 214 (4), 1111-1128 (2017) PUBMED 28351984 REFERENCE 5 (bases 1 to 698) AUTHORS Zahid,H.M., Ferdaus,M.Z., Ohara,H., Isomura,M. and Nabika,T. TITLE Effect of p22phox depletion on sympathetic regulation of blood pressure in SHRSP: evaluation in a new congenic strain JOURNAL Sci Rep 6, 36739 (2016) PUBMED 27824157 REMARK GeneRIF: p22phox has a role in sympathetic regulation of blood pressure in stroke-prone spontaneously hypertensive rats Publication Status: Online-Only REFERENCE 6 (bases 1 to 698) AUTHORS Fukui,T., Lassegue,B., Kai,H., Alexander,R.W. and Griendling,K.K. TITLE Cytochrome b-558 alpha-subunit cloning and expression in rat aortic smooth muscle cells JOURNAL Biochim Biophys Acta 1231 (3), 215-219 (1995) PUBMED 7578211 REFERENCE 7 (bases 1 to 698) AUTHORS de Boer,M., de Klein,A., Hossle,J.P., Seger,R., Corbeel,L., Weening,R.S. and Roos,D. TITLE Cytochrome b558-negative, autosomal recessive chronic granulomatous disease: two new mutations in the cytochrome b558 light chain of the NADPH oxidase (p22-phox) JOURNAL Am J Hum Genet 51 (5), 1127-1135 (1992) PUBMED 1415254 REFERENCE 8 (bases 1 to 698) AUTHORS Dinauer,M.C., Pierce,E.A., Erickson,R.W., Muhlebach,T.J., Messner,H., Orkin,S.H., Seger,R.A. and Curnutte,J.T. TITLE Point mutation in the cytoplasmic domain of the neutrophil p22-phox cytochrome b subunit is associated with a nonfunctional NADPH oxidase and chronic granulomatous disease JOURNAL Proc Natl Acad Sci U S A 88 (24), 11231-11235 (1991) PUBMED 1763037 REFERENCE 9 (bases 1 to 698) AUTHORS Dinauer,M.C., Pierce,E.A., Bruns,G.A., Curnutte,J.T. and Orkin,S.H. TITLE Human neutrophil cytochrome b light chain (p22-phox). Gene structure, chromosomal location, and mutations in cytochrome-negative autosomal recessive chronic granulomatous disease JOURNAL J Clin Invest 86 (5), 1729-1737 (1990) PUBMED 2243141 REFERENCE 10 (bases 1 to 698) AUTHORS Parkos,C.A., Allen,R.A., Cochrane,C.G. and Jesaitis,A.J. TITLE Purified cytochrome b from human granulocyte plasma membrane is comprised of two polypeptides with relative molecular weights of 91,000 and 22,000 JOURNAL J Clin Invest 80 (3), 732-742 (1987) PUBMED 3305576 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAXUCZ010000019.1. On Dec 2, 2020 this sequence version replaced NM_024160.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: U18729.1, AJ295951.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN16676784, SAMN16676789 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-91 JAXUCZ010000019.1 67404124-67404214 c 92-161 JAXUCZ010000019.1 67399209-67399278 c 162-236 JAXUCZ010000019.1 67398743-67398817 c 237-320 JAXUCZ010000019.1 67398470-67398553 c 321-402 JAXUCZ010000019.1 67397558-67397639 c 403-698 JAXUCZ010000019.1 67396143-67396438 c FEATURES Location/Qualifiers source 1..698 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="19" /map="19q12" gene 1..698 /gene="Cyba" /gene_synonym="p22-phox; Phox" /note="cytochrome b-245 alpha chain" /db_xref="GeneID:79129" /db_xref="RGD:620573" exon 1..91 /gene="Cyba" /gene_synonym="p22-phox; Phox" /inference="alignment:Splign:2.1.0" CDS 34..612 /gene="Cyba" /gene_synonym="p22-phox; Phox" /note="p22phox; p22 phagocyte B-cytochrome; cytochrome b(558) alpha chain; cytochrome b558 subunit alpha; neutrophil cytochrome b 22 kDa polypeptide; superoxide-generating NADPH oxidase light chain subunit; cytochrome b558 alpha-subunit; cytochrome b-245, alpha polypeptide; alpha-subunit p22" /codon_start=1 /product="cytochrome b-245 light chain" /protein_id="NP_077074.1" /db_xref="GeneID:79129" /db_xref="RGD:620573" /translation="
MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVLICLLEYPRGKRKKGSTMERCGQKYLTAVVKLFGPLTRNYYVRAVLHLLLSVPAGFLLATILGTVCLAIASVIYLLAAIRGEQWTPIEPKPKERPQVGGTIKQPPTNPPPRPPAEVRKKPSEAEEEAASAGGPQVNPIPVTDEVV"
misc_feature 37..603 /gene="Cyba" /gene_synonym="p22-phox; Phox" /note="Cytochrome Cytochrome b558 alpha-subunit; Region: Cytochrom_B558a; pfam05038" /db_xref="CDD:461532" misc_feature 433..609 /gene="Cyba" /gene_synonym="p22-phox; Phox" /note="propagated from UniProtKB/Swiss-Prot (Q62737.3); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 472..474 /gene="Cyba" /gene_synonym="p22-phox; Phox" /note="Phosphothreonine. /evidence=ECO:0000250|UniProtKB:P13498; propagated from UniProtKB/Swiss-Prot (Q62737.3); phosphorylation site" misc_feature 535..537 /gene="Cyba" /gene_synonym="p22-phox; Phox" /note="Phosphoserine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (Q62737.3); phosphorylation site" misc_feature 559..561 /gene="Cyba" /gene_synonym="p22-phox; Phox" /note="Phosphoserine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (Q62737.3); phosphorylation site" exon 92..161 /gene="Cyba" /gene_synonym="p22-phox; Phox" /inference="alignment:Splign:2.1.0" exon 162..236 /gene="Cyba" /gene_synonym="p22-phox; Phox" /inference="alignment:Splign:2.1.0" exon 237..320 /gene="Cyba" /gene_synonym="p22-phox; Phox" /inference="alignment:Splign:2.1.0" exon 321..402 /gene="Cyba" /gene_synonym="p22-phox; Phox" /inference="alignment:Splign:2.1.0" exon 403..698 /gene="Cyba" /gene_synonym="p22-phox; Phox" /inference="alignment:Splign:2.1.0" ORIGIN
ggaccgagcggctgcgtgtgctgggtcctcaccatggggcagatcgagtgggccatgtgggccaacgaacaggcgctggcatctggcctgatcctcatcacagggggcatcgtggctactgcgggacgcttcacgcagtggtactttggtgcttactctattgttgcaggagtgctcatctgtctgctggagtacccccggggaaagaggaaaaagggctccaccatggagcggtgtggacagaagtacctgaccgctgtggtgaagctgttcgggcccctcaccagaaattactacgtccgggctgtcctccacttactgctgtccgtgcctgcaggcttcctgctggccaccatcctggggaccgtctgcttggccattgccagtgtgatctacctgctggcagccatccggggtgagcagtggactcccattgagcctaaacccaaggagcggccgcaggttggaggcaccatcaagcagccacctaccaaccccccaccccggccaccagcggaggtccgcaagaagccaagtgaggccgaagaggaggcagcctcggcaggaggaccccaggttaacccaattccagtgacagatgaggtcgtgtgaccttcagtggctcctgcttgagtttccaaggtgttgctcccagagggtggtgatgcccactgtaataaacatggttaatagctggt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]