GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-01 07:58:09, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       NM_012671               4222 bp    mRNA    linear   ROD 29-MAR-2024
DEFINITION  Rattus norvegicus transforming growth factor alpha (Tgfa), mRNA.
ACCESSION   NM_012671
VERSION     NM_012671.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 4222)
  AUTHORS   Yu,Y., Chen,E., Weiss,R.M., Felder,R.B. and Wei,S.G.
  TITLE     Transforming Growth Factor-alpha Acts in Hypothalamic
            Paraventricular Nucleus to Upregulate ERK1/2 Signaling and
            Expression of Sympathoexcitatory Mediators in Heart Failure Rats
  JOURNAL   Neuroscience 483, 13-23 (2022)
   PUBMED   34968668
  REMARK    GeneRIF: Transforming Growth Factor-alpha Acts in Hypothalamic
            Paraventricular Nucleus to Upregulate ERK1/2 Signaling and
            Expression of Sympathoexcitatory Mediators in Heart Failure Rats.
REFERENCE   2  (bases 1 to 4222)
  AUTHORS   Naito,K., Moteki,H., Kimura,M., Natsume,H. and Ogihara,M.
  TITLE     Serotonin 5-HT2B Receptor-Stimulated DNA Synthesis and
            Proliferation Are Mediated by Autocrine Secretion of Transforming
            Growth Factor-alpha in Primary Cultures of Adult Rat Hepatocytes
  JOURNAL   Biol Pharm Bull 39 (4), 570-577 (2016)
   PUBMED   26804134
  REMARK    GeneRIF: 5-HT stimulates DNA synthesis and proliferation in primary
            cultures of adult rat hepatocytes by acting via autocrine secretion
            of TGF-alpha induced by the serotonin 5-HT2B receptor/Gq/PLC/Ca2+
            pathway.
REFERENCE   3  (bases 1 to 4222)
  AUTHORS   Ni,W., Lin,N., He,H., Zhu,J. and Zhang,Y.
  TITLE     Lipopolysaccharide induces up-regulation of TGF-alpha through HDAC2
            in a rat model of bronchopulmonary dysplasia
  JOURNAL   PLoS One 9 (3), e91083 (2014)
   PUBMED   24595367
  REMARK    GeneRIF: Lipopolysaccharide exposure led to a suppression of both
            HDAC1 and HDAC2 expression and activity, induced TGFa expression,
            and disrupted alveolar morphology.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 4222)
  AUTHORS   Wong,H.H. and Lemoine,N.R.
  TITLE     Pancreatic cancer: molecular pathogenesis and new therapeutic
            targets
  JOURNAL   Nat Rev Gastroenterol Hepatol 6 (7), 412-422 (2009)
   PUBMED   19506583
  REMARK    Review article
REFERENCE   5  (bases 1 to 4222)
  AUTHORS   Kimura,M., Okamoto,H., Natsume,H. and Ogihara,M.
  TITLE     IP receptor agonist-induced DNA synthesis and proliferation in
            primary cultures of adult rat hepatocytes: the involvement of
            endogenous transforming growth factor-alpha
  JOURNAL   J Pharmacol Sci 109 (4), 618-629 (2009)
   PUBMED   19346670
REFERENCE   6  (bases 1 to 4222)
  AUTHORS   Korc,M., Chandrasekar,B., Yamanaka,Y., Friess,H., Buchier,M. and
            Beger,H.G.
  TITLE     Overexpression of the epidermal growth factor receptor in human
            pancreatic cancer is associated with concomitant increases in the
            levels of epidermal growth factor and transforming growth factor
            alpha
  JOURNAL   J Clin Invest 90 (4), 1352-1360 (1992)
   PUBMED   1401070
REFERENCE   7  (bases 1 to 4222)
  AUTHORS   Luetteke,N.C. and Lee,D.C.
  TITLE     Transforming growth factor alpha: expression, regulation and
            biological action of its integral membrane precursor
  JOURNAL   Semin Cancer Biol 1 (4), 265-275 (1990)
   PUBMED   2103501
  REMARK    Review article
REFERENCE   8  (bases 1 to 4222)
  AUTHORS   Blasband,A.J., Rogers,K.T., Chen,X.R., Azizkhan,J.C. and Lee,D.C.
  TITLE     Characterization of the rat transforming growth factor alpha gene
            and identification of promoter sequences
  JOURNAL   Mol Cell Biol 10 (5), 2111-2121 (1990)
   PUBMED   2325647
REFERENCE   9  (bases 1 to 4222)
  AUTHORS   Gentry,L.E., Twardzik,D.R., Lim,G.J., Ranchalis,J.E. and Lee,D.C.
  TITLE     Expression and characterization of transforming growth factor alpha
            precursor protein in transfected mammalian cells
  JOURNAL   Mol Cell Biol 7 (5), 1585-1591 (1987)
   PUBMED   3299049
REFERENCE   10 (bases 1 to 4222)
  AUTHORS   Lee,D.C., Rose,T.M., Webb,N.R. and Todaro,G.J.
  TITLE     Cloning and sequence analysis of a cDNA for rat transforming growth
            factor-alpha
  JOURNAL   Nature 313 (6002), 489-491 (1985)
   PUBMED   3855503
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            M31076.1 and JAXUCZ010000004.1.
            
            On Jun 13, 2010 this sequence version replaced NM_012671.1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: M31076.1, SRR26643288.19572.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760383, SAMEA5760389
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-804               M31076.1           1-804
            805-4222            JAXUCZ010000004.1  120254920-120258337
FEATURES             Location/Qualifiers
     source          1..4222
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="4"
                     /map="4q34"
     gene            1..4222
                     /gene="Tgfa"
                     /gene_synonym="RATTGFAA; TGFAA"
                     /note="transforming growth factor alpha"
                     /db_xref="GeneID:24827"
                     /db_xref="RGD:3849"
     exon            1..184
                     /gene="Tgfa"
                     /gene_synonym="RATTGFAA; TGFAA"
                     /inference="alignment:Splign:2.1.0"
     CDS             145..624
                     /gene="Tgfa"
                     /gene_synonym="RATTGFAA; TGFAA"
                     /note="protransforming growth factor alpha"
                     /codon_start=1
                     /product="protransforming growth factor alpha
                     preproprotein"
                     /protein_id="NP_036803.1"
                     /db_xref="GeneID:24827"
                     /db_xref="RGD:3849"
                     /translation="
MVPAAGQLALLALGILVAVCQALENSTSPLSDSPVAAAVVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALVCRHEKPSALLKGRTACCHSETVV"
     sig_peptide     145..213
                     /gene="Tgfa"
                     /gene_synonym="RATTGFAA; TGFAA"
                     /note="/evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (P01134.2)"
     proprotein      211..621
                     /gene="Tgfa"
                     /gene_synonym="RATTGFAA; TGFAA"
                     /product="transforming growth factor alpha proprotein"
     misc_feature    217..219
                     /gene="Tgfa"
                     /gene_synonym="RATTGFAA; TGFAA"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (P01134.2); glycosylation site"
     mat_peptide     259..408
                     /gene="Tgfa"
                     /gene_synonym="RATTGFAA; TGFAA"
                     /product="transforming growth factor alpha"
     misc_feature    <271..390
                     /gene="Tgfa"
                     /gene_synonym="RATTGFAA; TGFAA"
                     /note="EGF-like protein; Provisional; Region: PHA02887"
                     /db_xref="CDD:165214"
     misc_feature    <280..504
                     /gene="Tgfa"
                     /gene_synonym="RATTGFAA; TGFAA"
                     /note="epidermal growth factor-like protein (EGF-like
                     protein); Provisional; Region: PHA03099"
                     /db_xref="CDD:165381"
     misc_feature    436..513
                     /gene="Tgfa"
                     /gene_synonym="RATTGFAA; TGFAA"
                     /note="propagated from UniProtKB/Swiss-Prot (P01134.2);
                     transmembrane region"
     exon            185..238
                     /gene="Tgfa"
                     /gene_synonym="RATTGFAA; TGFAA"
                     /inference="alignment:Splign:2.1.0"
     exon            239..356
                     /gene="Tgfa"
                     /gene_synonym="RATTGFAA; TGFAA"
                     /inference="alignment:Splign:2.1.0"
     exon            357..506
                     /gene="Tgfa"
                     /gene_synonym="RATTGFAA; TGFAA"
                     /inference="alignment:Splign:2.1.0"
     exon            507..616
                     /gene="Tgfa"
                     /gene_synonym="RATTGFAA; TGFAA"
                     /inference="alignment:Splign:2.1.0"
     exon            617..4222
                     /gene="Tgfa"
                     /gene_synonym="RATTGFAA; TGFAA"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ccgggaggcgcggtcgtccctccgcccgcgcgccgggggccggccctgtcgcctgcgcctttttcccccgcgcacaccgcggcggcgcgcggccactcgccaaccgcaaagagcgcggtggctgcagcgccctgcgctcggaagatggtccccgcggccggacagctcgctctgctagcgctgggtatcctggtagctgtgtgtcaggctctggagaacagcacgtcccccctgagtgactcacccgtggcggctgcagtggtgtctcacttcaacaagtgcccagattcccacactcagtattgtttccatgggacctgcaggtttttggtgcaggaagagaagccagcatgtgtctgccactctgggtacgtgggtgttcgctgtgagcatgcagatctcctggcagtggtggctgccagccagaagaagcaggccatcactgccctggtggtagtctccattgtggccctggctgtcctcattatcacctgtgtgctgatccactgctgtcaggtccgcaagcactgtgagtggtgccgtgccctcgtctgcagacacgagaagcccagcgccctcctgaaaggaaggactgcctgctgccactctgagacagtggtctgaagatcccagaggaggaatttggccaggtggccgatgacagcccaaccaaggaaaggtgtctcaggacaacaccaccagcagtgcccaggccccgggacatgctgggagaccttccccctcaatgtacaaccacctgggcagctctctgtcctttacgagcttcaaaactgtgtgataaagctgcccgctgggcaccctagagaagaggccagtagacaacatttgaacgacaagttgaacaagaacctcaaagggctggccttcttgctaacccacaccaagaaggctgtccgtggactccaaactgtttcttctccatgggccgtctaaccccccacagagactccacgcttggtgtacaaaatggacaaggggaaacatctattgtcctttgaagacaccatggccccggcatgagccctgacatctcctcaaacggttgccaggatgatgtgtcttatgtattaggtggatgacgcggttttgtttgtattctctttatgtcagtatcgggcatccatgttaatgatccacgagcggctggctgtgaagttacaccaaatagaaatgttcagccactttgataaagtaaggctgtggggatgggagcctcccaggggctgtagagacagaactcaaaagtgcattctgctgggaaccaaactgctaccaggaggttgtgcccactaagacaggaaagtccctggatatatgctgtggcaaagttagcaagggcaagaggacaagagagcctgtgtgggcactgagggaggacgcacattccatcactcgattaagttggattagcctcctcgtgagcccagctccagcatcagccatgagccgtgggccaaatccgtgaaggtgaccccctctttattggtttctgctcatttttagaaggagaaatttacctttcctatttattttcaagcattaagagaaatagcccccctgtcttgttttgttttgtttcccctttcagaatgttggcattactaatgaaatcgctaccaagcctctccactcccctccggggaaggagctatgttccctgagcactggagggcgctctgacccattgagcccacctcctccctgtgctgctcaggactgtcaggagacagtaaatacatccagctgcttgtggaggaggccattctccaactcagaacttaaagggccctccaccctccagagcctttaacgtaacgtcaggaaaaggggtgtttgacataccaaattctcagcaagttctgcctgttcctcattcttctccattccacctttctctgtgaatgttttcttttctcatatgacctagatatcaatctgcccaggtcttaaccctggctccctttgttaacaatgcctcaagctccacaagaagaaagtgggttggttcagtgctgacctctaactactcagtcgacgtggctccaggcggaaatcgtcacttgtgttgttattattattattattttggtttgatgttttatcttgttttgtgagacaaggtcttgctgtgtagcccaggttggccttgaagttaagatcctcctgcttcagcatcctgagagctgggcttactggtgtacagcaccgcacccagcagagtctttacggttattaaagaagacaggttaagtttgctttccttgggtcgtgcatgtgggtcaaggccaagtgtagcctgctgctcagacacccatcgacctcactggacgttggccctctattgggcccccaatgcagaccctgtatgaagtactagctcaccagggccaacacaaagggaggggcttgttttaatttagttcacaccgttagcttccgatgataagtctttcctggtctgttggaagctcctgggtgtctgacttcttttaaagagtttgaactgatatcaaaatatcattgggaatttcttcacctagtgtcccatcctgaagatattaccatgcaagactcagcagaggtgggaaaagttagtacaaacctttaatggtggaggcagaggatcttgggaggacctcagctttagtgtctgaacattccggttctcaggtccagccagtcacagcagccagtaccatcccagtacccatacacagatgcagccggctcaaacgtctcccagaagtgccttccccaccagtcataccctctgaagagtcagaagctgagactaagttgaggcaaatctggttggacatcgtccctgccctgacataagacagccctgcttctttggtgactctgattcttggaagtcagacaaatgctgacagcacaaatctcacagcacagttagacctgggtagctgtcccagcacctcctgtcaggtcacactggccctcttgatactcagtgcagctactgagtcaggagcactcgtcagcagacacacaggtcagtggacagtgactcagaggactgtgaacattcccattaaatggattgaaattaattctggagtcattaagagagctcagttaagaatggcacttaccaatatccctgagaacatgagttcaatcccctgggacccatctggtggaaggagagaaccaacttgcccaggatgtcttctgaattctacatacacaacacacacacacacacacacacacacacacacacacacacacccctctagctgtaactttaaacacatgatgggacatgttctctccatgcaaaactacaatggggactcagtctgaaagatagattctaggtggacatacgcagacccaaaccataagtcagtttgtcatgtgcccagaaaaaggtggtaacaatagtcccaatgtcctttttctcctaaaaaggttgtggggaggcatggttggtacccacccacccacactggtgagggaagtgactgtgtccctgagtcttagatggtgatgttgttccctgcaagtccccaggccaggtttcctagtgcctgtgagccactaggtggaccggcaacacgctgacactgcctacaggccccagtcccatggtgaatagtaaggttacctctctcaaaggccaaggggaggccacatgagacaacacgtttttcacacagggtttcactgtatagcccaggccagcctcaaacccatgattcccctgcctcagcctactgggttacaggtgtgcactgccatacctggctcacgtttgttttttaatgttctggtgtaacatgtattccctgaagccattgatctatctcaaagacacagtgttgtacgcatacatgtgcgcacgtacacacaccaaactggaaagcgacccctctccatagtgtgataagtttattataagtttattataaggaccctatgctgtttttagaactcatctttctgacttctgtatatgatgcactgaaggttaatatgtaatattttaatttattttatgtggtaagttaattttggttttctgtaatgtattaatgtgattagaagcttttttccttaatatctgaattatacttaaagagtagtgaggaatataagatactgttgtgtattgttactcagttgtattgtaccttgtttggaaggatgaaggaatgaaccctttttttttttc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]