ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2024-11-01 09:37:26, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS NM_001398657 1245 bp mRNA linear ROD 31-MAR-2024
DEFINITION Rattus norvegicus cyclin-dependent kinase 7 (Cdk7), transcript
variant 2, mRNA.
ACCESSION NM_001398657
VERSION NM_001398657.1
KEYWORDS RefSeq.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 1245)
AUTHORS Jeronimo,C., Bataille,A.R. and Robert,F.
TITLE The writers, readers, and functions of the RNA polymerase II
C-terminal domain code
JOURNAL Chem Rev 113 (11), 8491-8522 (2013)
PUBMED 23837720
REMARK Review article
REFERENCE 2 (bases 1 to 1245)
AUTHORS Wang,Y., Liu,F., Mao,F., Hang,Q., Huang,X., He,S., Wang,Y.,
Cheng,C., Wang,H., Xu,G., Zhang,T. and Shen,A.
TITLE Interaction with cyclin H/cyclin-dependent kinase 7 (CCNH/CDK7)
stabilizes C-terminal binding protein 2 (CtBP2) and promotes cancer
cell migration
JOURNAL J Biol Chem 288 (13), 9028-9034 (2013)
PUBMED 23393140
REFERENCE 3 (bases 1 to 1245)
AUTHORS Egloff,S., Dienstbier,M. and Murphy,S.
TITLE Updating the RNA polymerase CTD code: adding gene-specific layers
JOURNAL Trends Genet 28 (7), 333-341 (2012)
PUBMED 22622228
REMARK Review article
REFERENCE 4 (bases 1 to 1245)
AUTHORS Fujii,W., Nishimura,T., Kano,K., Sugiura,K. and Naito,K.
TITLE CDK7 and CCNH are components of CDK-activating kinase and are
required for meiotic progression of pig oocytes
JOURNAL Biol Reprod 85 (6), 1124-1132 (2011)
PUBMED 21778139
REFERENCE 5 (bases 1 to 1245)
AUTHORS Egly,J.M. and Coin,F.
TITLE A history of TFIIH: two decades of molecular biology on a pivotal
transcription/repair factor
JOURNAL DNA Repair (Amst) 10 (7), 714-721 (2011)
PUBMED 21592869
REMARK Review article
REFERENCE 6 (bases 1 to 1245)
AUTHORS Kershnar,E., Wu,S.Y. and Chiang,C.M.
TITLE Immunoaffinity purification and functional characterization of
human transcription factor IIH and RNA polymerase II from clonal
cell lines that conditionally express epitope-tagged subunits of
the multiprotein complexes
JOURNAL J Biol Chem 273 (51), 34444-34453 (1998)
PUBMED 9852112
REFERENCE 7 (bases 1 to 1245)
AUTHORS Reardon,J.T., Ge,H., Gibbs,E., Sancar,A., Hurwitz,J. and Pan,Z.Q.
TITLE Isolation and characterization of two human transcription factor
IIH (TFIIH)-related complexes: ERCC2/CAK and TFIIH
JOURNAL Proc Natl Acad Sci U S A 93 (13), 6482-6487 (1996)
PUBMED 8692841
REMARK Erratum:[Proc Natl Acad Sci U S A 1996 Sep 17;93(19):10538]
REFERENCE 8 (bases 1 to 1245)
AUTHORS Weiler,M.C., Smith,J.L. and Masters,J.N.
TITLE CR16, a novel proline-rich protein expressed in rat brain neurons,
binds to SH3 domains and is a MAP kinase substrate
JOURNAL J Mol Neurosci 7 (3), 203-215 (1996)
PUBMED 8906616
REFERENCE 9 (bases 1 to 1245)
AUTHORS Ossipow,V., Tassan,J.P., Nigg,E.A. and Schibler,U.
TITLE A mammalian RNA polymerase II holoenzyme containing all components
required for promoter-specific transcription initiation
JOURNAL Cell 83 (1), 137-146 (1995)
PUBMED 7553866
REFERENCE 10 (bases 1 to 1245)
AUTHORS Serizawa,H., Makela,T.P., Conaway,J.W., Conaway,R.C., Weinberg,R.A.
and Young,R.A.
TITLE Association of Cdk-activating kinase subunits with transcription
factor TFIIH
JOURNAL Nature 374 (6519), 280-282 (1995)
PUBMED 7885450
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
JAXUCZ010000002.1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
RNAseq introns :: mixed sample support SAMEA5760383, SAMEA5760389
[ECO:0006172]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-172 JAXUCZ010000002.1 33599314-33599485 c
173-232 JAXUCZ010000002.1 33598993-33599052 c
233-266 JAXUCZ010000002.1 33593218-33593251 c
267-334 JAXUCZ010000002.1 33591851-33591918 c
335-445 JAXUCZ010000002.1 33586594-33586704 c
446-564 JAXUCZ010000002.1 33585525-33585643 c
565-664 JAXUCZ010000002.1 33582765-33582864 c
665-751 JAXUCZ010000002.1 33581125-33581211 c
752-901 JAXUCZ010000002.1 33577478-33577627 c
902-1049 JAXUCZ010000002.1 33575715-33575862 c
1050-1245 JAXUCZ010000002.1 33574623-33574818 c
FEATURES Location/Qualifiers
source 1..1245
/organism="Rattus norvegicus"
/mol_type="mRNA"
/strain="BN"
/db_xref="taxon:10116"
/chromosome="2"
/map="2q12"
gene 1..1245
/gene="Cdk7"
/gene_synonym="CAK; P39 Mo15"
/note="cyclin-dependent kinase 7"
/db_xref="GeneID:171150"
/db_xref="RGD:621124"
exon 1..172
/gene="Cdk7"
/gene_synonym="CAK; P39 Mo15"
/inference="alignment:Splign:2.1.0"
misc_feature 23..25
/gene="Cdk7"
/gene_synonym="CAK; P39 Mo15"
/note="upstream in-frame stop codon"
CDS 107..1078
/gene="Cdk7"
/gene_synonym="CAK; P39 Mo15"
/EC_number="2.7.11.23"
/EC_number="2.7.11.22"
/note="isoform 2 is encoded by transcript variant 2; cell
division protein kinase 7; 39 protein kinase;
CDK-activating kinase 1; TFIIH basal transcription factor
complex kinase subunit; cyclin-dependent kinase 7 (MO15
homolog, Xenopus laevis, cdk-activating kinase);
cyclin-dependent kinase 7 (homolog of Xenopus MO15
cdk-activating kinase)"
/codon_start=1
/product="cyclin-dependent kinase 7 isoform 2"
/protein_id="NP_001385586.1"
/db_xref="GeneID:171150"
/db_xref="RGD:621124"
/translation="
MAVDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLQHIFIAAGDDLLELIQGLFLFNPCTRITASQALRTKYFSNRPGPTPGCQLPRPNCPVEALKEQSNPAMATKRKRAEALEQGILPKKLIF"
misc_feature 137..961
/gene="Cdk7"
/gene_synonym="CAK; P39 Mo15"
/note="Catalytic domain of the Serine/Threonine Kinase,
Cyclin-Dependent protein Kinase 7; Region: STKc_CDK7;
cd07841"
/db_xref="CDD:270833"
misc_feature order(158..169,173..178,182..184,221..223,227..229,
287..289,329..331,335..337,446..448,452..454,458..463,
467..469,500..502,509..511,515..517,545..547,551..562,
566..568,680..685)
/gene="Cdk7"
/gene_synonym="CAK; P39 Mo15"
/note="active site"
/db_xref="CDD:270833"
misc_feature order(263..271,275..277,284..289,293..298,305..310,
413..415,422..433,515..517,521..532,542..547,878..880,
890..898)
/gene="Cdk7"
/gene_synonym="CAK; P39 Mo15"
/note="CDK/cyclin interface [polypeptide binding]; other
site"
/db_xref="CDD:270833"
misc_feature order(287..289,446..448,452..454,509..511,545..547,
551..562,566..568,680..685)
/gene="Cdk7"
/gene_synonym="CAK; P39 Mo15"
/note="polypeptide substrate binding site [polypeptide
binding]; other site"
/db_xref="CDD:270833"
misc_feature order(497..532,536..568)
/gene="Cdk7"
/gene_synonym="CAK; P39 Mo15"
/note="activation loop (A-loop); other site"
/db_xref="CDD:270833"
exon 173..232
/gene="Cdk7"
/gene_synonym="CAK; P39 Mo15"
/inference="alignment:Splign:2.1.0"
exon 233..266
/gene="Cdk7"
/gene_synonym="CAK; P39 Mo15"
/inference="alignment:Splign:2.1.0"
exon 267..334
/gene="Cdk7"
/gene_synonym="CAK; P39 Mo15"
/inference="alignment:Splign:2.1.0"
exon 335..445
/gene="Cdk7"
/gene_synonym="CAK; P39 Mo15"
/inference="alignment:Splign:2.1.0"
exon 446..564
/gene="Cdk7"
/gene_synonym="CAK; P39 Mo15"
/inference="alignment:Splign:2.1.0"
exon 565..664
/gene="Cdk7"
/gene_synonym="CAK; P39 Mo15"
/inference="alignment:Splign:2.1.0"
exon 665..751
/gene="Cdk7"
/gene_synonym="CAK; P39 Mo15"
/inference="alignment:Splign:2.1.0"
exon 752..901
/gene="Cdk7"
/gene_synonym="CAK; P39 Mo15"
/inference="alignment:Splign:2.1.0"
exon 902..1049
/gene="Cdk7"
/gene_synonym="CAK; P39 Mo15"
/inference="alignment:Splign:2.1.0"
exon 1050..1245
/gene="Cdk7"
/gene_synonym="CAK; P39 Mo15"
/inference="alignment:Splign:2.1.0"
ORIGIN
atgcgcgtccagtgaacggaagtagctgttggaaactttcagacgctttaaattcctgcggggtggagggcttagtttagctgctggacgctggcttctcactcgtatggctgtggacgtgaaatctcgagcgaagcgctatgagaaactggacttcctcggagagggacagtttgctactgtctataaggccagagataagaacaccaaccagatcgtcgccattaagaaaatcaaacttggacacaggtcagaagctaaagatggtataaatagaacagccttaagggagataaagctcttgcaggaactaagtcatccaaatataattggtgttatcataaaggataacagtctcgtgttgaccccatcccacattaaagcctacatgctgatgactcttcagggcttggaatatttacatcagcactggattctacacagggatctgaaaccaaacaacttgttgttagatgagaatggagttctgaaactggcagattttggcctggccaaatcatttgggagccccaatagggcttacacacatcaagttgtgaccaggtggtaccgggcccccgagttactgtttggagctaggatgtacggtgtgggagtggacatgtgggctgtcggttgtatcttagcagaattgcttctaagggttccttttttgcctggagattcagaccttgatcagctaacaagaatatttgaaactctgggtacaccaaccgaagaacagtggcctgacatgtgtagtcttccagattacgtgacgttcaagagtttccctggcatccccctgcagcacatcttcattgcagctggagacgacctgcttgagctcatacaaggcttgttcttattcaacccatgtactagaattacagcttcacaggcgttgaggaccaagtacttcagtaatcgtccagggccaacacctggatgccagcttccaagaccaaactgtccagtggaagcattaaaggaacagtcaaatccagccatggcgacaaaacggaaaagagcggaggccttagaacaaggaatattgcccaagaagctaattttttagttgcagcgaacaatggacagtttcactgctgaaagaaatgatccaaaggcaaataacggaaaaaaaatagggaatattaaatactatataagaacttgtaaatactctacagatgtaaaatatgtaaagctatgggttatttttattaaatgtattttaaaataaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]