ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-04-24 17:16:21, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_063274594 808 bp mRNA linear ROD 22-FEB-2024
DEFINITION PREDICTED: Rattus norvegicus TPD52 like 1 (Tpd52l1), transcript
variant X5, mRNA.
ACCESSION XM_063274594
VERSION XM_063274594.1
DBLINK BioProject: PRJNA1074393
KEYWORDS RefSeq.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_086019) annotated using gene prediction method: Gnomon,
supported by EST evidence.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI RefSeq
Annotation Status :: Full annotation
Annotation Name :: GCF_036323735.1-RS_2024_02
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 10.2
Annotation Method :: Best-placed RefSeq; Gnomon;
cmsearch; tRNAscan-SE
Features Annotated :: Gene; mRNA; CDS; ncRNA
Annotation Date :: 02/09/2024
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..808
/organism="Rattus norvegicus"
/mol_type="mRNA"
/strain="BN/NHsdMcwi"
/bio_material="RGD 61498"
/db_xref="taxon:10116"
/chromosome="1"
/sex="male"
/tissue_type="kidney, spleen, liver"
/geo_loc_name="USA: Wisconsin, Milwaukee"
/lat_lon="43.05 N 88.04 W"
/collected_by="Rebecca Schilling, Melinda Dwinell"
gene 1..808
/gene="Tpd52l1"
/note="TPD52 like 1; Derived by automated computational
analysis using gene prediction method: Gnomon. Supporting
evidence includes similarity to: 4 ESTs, 14 long SRA
reads, 7 Proteins"
/db_xref="GeneID:689256"
/db_xref="RGD:1594796"
CDS 206..658
/gene="Tpd52l1"
/codon_start=1
/product="tumor protein D53 isoform X5"
/protein_id="XP_063130664.1"
/db_xref="GeneID:689256"
/db_xref="RGD:1594796"
/translation="
MEAQAQGLLETEPLQGRDGDAIGSADLSSMLSEEEKDELKAELVQLEEEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSRSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISRKFGDMRNSPTFKSFEERVETTVTSLKV"
misc_feature 296..619
/gene="Tpd52l1"
/note="Tumour protein D52 family; Region: TPD52;
pfam04201"
/db_xref="CDD:461225"
ORIGIN
accaggtggactggaaggggcggaggtaaccagcagcggccagtggtggccgcccgcagtcccccgcctcctccacgcaacgctcgcccagaagagggcacgggcggcgtggctggcagtcttccgagctcgggcaccgctaccatctgctgctctgcgaggagtccgtggattccccgccgcgctcagctccacgccggccaccatggaggcgcaggcacaaggcttgttggagacggagccacttcaaggaagagatggggacgcaataggcagtgctgacctctctagcatgctttctgaggaggagaaggacgagctaaaggcagagttagttcagctagaagaggaaatcacaacattacgacaagttttgtcagcaaaagaaagacatctggttgagatcaaacagaaactcggcatgaacctgatgaacgagttaaagcagaacttcagcaggagctggcacgacatgcagaccacgactgcgtacaaaaaaacacacgaaaccctgagccacgcagggcagaaggcaacagcagctttcagtaatgtgggaactgccatcagcaggaagtttggcgatatgaggaattctcctactttcaaatcatttgaggagagggttgagacaactgttacaagcctcaaggtgtaaatgttttgcctacgaaagtaggtgggacaaaccacagtggtggcagttttgaggaggtcctgagctccacagcacacgccagctcccagaatgcttcagcaggcatccggcagaccagagaagaggatctgcagtgctaggcccagcctg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]