2025-09-16 09:32:12, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_039111978 1113 bp mRNA linear ROD 22-FEB-2024 DEFINITION PREDICTED: Rattus norvegicus trafficking protein particle complex subunit 6B (Trappc6b), transcript variant X2, mRNA. ACCESSION XM_039111978 VERSION XM_039111978.2 DBLINK BioProject: PRJNA1074393 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_086024) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Feb 22, 2024 this sequence version replaced XM_039111978.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_036323735.1-RS_2024_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/09/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1113 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN/NHsdMcwi" /bio_material="RGD 61498" /db_xref="taxon:10116" /chromosome="6" /sex="male" /tissue_type="kidney, spleen, liver" /geo_loc_name="USA: Wisconsin, Milwaukee" /lat_lon="43.05 N 88.04 W" /collected_by="Rebecca Schilling, Melinda Dwinell" gene 1..1113 /gene="Trappc6b" /gene_synonym="RGD1309325" /note="trafficking protein particle complex subunit 6B; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 77 long SRA reads, 1 Protein" /db_xref="GeneID:299075" /db_xref="RGD:1309325" CDS 222..587 /gene="Trappc6b" /gene_synonym="RGD1309325" /codon_start=1 /product="trafficking protein particle complex subunit 6B isoform X2" /protein_id="XP_038967906.1" /db_xref="GeneID:299075" /db_xref="RGD:1309325" /translation="
MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKDELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLIQLSAGKQYLEHASKANSR"
misc_feature 228..>572 /gene="Trappc6b" /gene_synonym="RGD1309325" /note="Trs33 subunit of the TRAPP complex; Region: TRAPPC6A_Trs33; cd14944" /db_xref="CDD:271347" misc_feature order(234..236,243..245,255..257,528..533,561..563) /gene="Trappc6b" /gene_synonym="RGD1309325" /note="synbindin interface [polypeptide binding]; other site" /db_xref="CDD:271347" misc_feature order(237..242,246..254,258..263,270..272,324..326, 336..338,345..350,357..362,369..371,444..446,453..455, 513..515) /gene="Trappc6b" /gene_synonym="RGD1309325" /note="BET3 interface [polypeptide binding]; other site" /db_xref="CDD:271347" polyA_site 1113 /gene="Trappc6b" /gene_synonym="RGD1309325" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
agcccggaagttgctcacgccccacaccctgccggaacgccgggtgtggggttgtcatagggtctcaaaggcccagtggcggccgccctggggaggggcgcggtccacagcggccttaggaccggggtaggccgcggcgcacagcgtgcgacgcggggtaacgggaacctcgagtcccgcactaattggagccgactcggcgctggagggatcggcgggaaatggcggacgaggcgttgtttttgcttctccataacgagatggtgtccggagtatataagtccgccgagcagggggaagtggaaaatggacggtgtattactaagctggaaaacatggggtttcgagtgggacaaggattgatagaaaggtttacaaaagatactgcaaggttcaaggatgaattagacatcatgaagttcatatgtaaagatttttggactacggtattcaagaaacaaattgacaatctaaggacaaatcatcagggcatatatgtgcttcaggacaacaaatttcgactactcattcagctgtctgcaggaaaacagtatttagaacatgcatccaaggcaaattccaggtgatgatacagaagctgtagagtgaggtgatggctcctgggcagagcattgcgcgtcctgatttcaccttctcgttggatatctgcgttggagcaaatcgttagctctccagagtcactagagcaaatcaaagtagatacaggtcctttgacataaactaactgaactgttcaaagcaatttcagtgaactaaacgccaagatgccaggctcttcattttaaacatctttatttccgtagtatgataagcatttaaccatcaattgggaagtgaaactcagggtgtgttgaattgctgtataaaaaagtacgtgtcaatcagaatagtttgtgttcaaatgaccaaaatttgttgaagtataaatctgttttagttatttaaaacaaaccactatgttaaattaagcttcatttttattgtattgcttataatttatttctgtcaagagaactcctatgcttatataaggatttcatttatacattgtgtatatatgtgtatatataaatacatgcattactgtctaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]