LOCUS       XM_039111978            1113 bp    mRNA    linear   ROD 22-FEB-2024
DEFINITION  PREDICTED: Rattus norvegicus trafficking protein particle complex
            subunit 6B (Trappc6b), transcript variant X2, mRNA.
ACCESSION   XM_039111978
VERSION     XM_039111978.2
DBLINK      BioProject: PRJNA1074393
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_086024) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Feb 22, 2024 this sequence version replaced XM_039111978.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_036323735.1-RS_2024_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/09/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1113
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN/NHsdMcwi"
                     /bio_material="RGD 61498"
                     /db_xref="taxon:10116"
                     /chromosome="6"
                     /sex="male"
                     /tissue_type="kidney, spleen, liver"
                     /geo_loc_name="USA: Wisconsin, Milwaukee"
                     /lat_lon="43.05 N 88.04 W"
                     /collected_by="Rebecca Schilling, Melinda Dwinell"
     gene            1..1113
                     /gene="Trappc6b"
                     /gene_synonym="RGD1309325"
                     /note="trafficking protein particle complex subunit 6B;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 77 long SRA reads, 1 Protein"
                     /db_xref="GeneID:299075"
                     /db_xref="RGD:1309325"
     CDS             222..587
                     /gene="Trappc6b"
                     /gene_synonym="RGD1309325"
                     /codon_start=1
                     /product="trafficking protein particle complex subunit 6B
                     isoform X2"
                     /protein_id="XP_038967906.1"
                     /db_xref="GeneID:299075"
                     /db_xref="RGD:1309325"
                     /translation="

MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKDELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLIQLSAGKQYLEHASKANSR"

     misc_feature    228..>572
                     /gene="Trappc6b"
                     /gene_synonym="RGD1309325"
                     /note="Trs33 subunit of the TRAPP complex; Region:
                     TRAPPC6A_Trs33; cd14944"
                     /db_xref="CDD:271347"
     misc_feature    order(234..236,243..245,255..257,528..533,561..563)
                     /gene="Trappc6b"
                     /gene_synonym="RGD1309325"
                     /note="synbindin interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:271347"
     misc_feature    order(237..242,246..254,258..263,270..272,324..326,
                     336..338,345..350,357..362,369..371,444..446,453..455,
                     513..515)
                     /gene="Trappc6b"
                     /gene_synonym="RGD1309325"
                     /note="BET3 interface [polypeptide binding]; other site"
                     /db_xref="CDD:271347"
     polyA_site      1113
                     /gene="Trappc6b"
                     /gene_synonym="RGD1309325"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      

agcccggaagttgctcacgccccacaccctgccggaacgccgggtgtggggttgtcatagggtctcaaaggcccagtggcggccgccctggggaggggcgcggtccacagcggccttaggaccggggtaggccgcggcgcacagcgtgcgacgcggggtaacgggaacctcgagtcccgcactaattggagccgactcggcgctggagggatcggcgggaaatggcggacgaggcgttgtttttgcttctccataacgagatggtgtccggagtatataagtccgccgagcagggggaagtggaaaatggacggtgtattactaagctggaaaacatggggtttcgagtgggacaaggattgatagaaaggtttacaaaagatactgcaaggttcaaggatgaattagacatcatgaagttcatatgtaaagatttttggactacggtattcaagaaacaaattgacaatctaaggacaaatcatcagggcatatatgtgcttcaggacaacaaatttcgactactcattcagctgtctgcaggaaaacagtatttagaacatgcatccaaggcaaattccaggtgatgatacagaagctgtagagtgaggtgatggctcctgggcagagcattgcgcgtcctgatttcaccttctcgttggatatctgcgttggagcaaatcgttagctctccagagtcactagagcaaatcaaagtagatacaggtcctttgacataaactaactgaactgttcaaagcaatttcagtgaactaaacgccaagatgccaggctcttcattttaaacatctttatttccgtagtatgataagcatttaaccatcaattgggaagtgaaactcagggtgtgttgaattgctgtataaaaaagtacgtgtcaatcagaatagtttgtgttcaaatgaccaaaatttgttgaagtataaatctgttttagttatttaaaacaaaccactatgttaaattaagcttcatttttattgtattgcttataatttatttctgtcaagagaactcctatgcttatataaggatttcatttatacattgtgtatatatgtgtatatataaatacatgcattactgtctaaa

//