GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-11 16:09:50, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_008773232            1258 bp    mRNA    linear   ROD 22-FEB-2024
DEFINITION  PREDICTED: Rattus norvegicus claudin 34D (Cldn34d), transcript
            variant X1, mRNA.
ACCESSION   XM_008773232
VERSION     XM_008773232.4
DBLINK      BioProject: PRJNA1074393
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_086039) annotated using gene prediction method: Gnomon,
            supported by mRNA evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Feb 22, 2024 this sequence version replaced XM_008773232.3.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_036323735.1-RS_2024_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/09/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1258
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN/NHsdMcwi"
                     /bio_material="RGD 61498"
                     /db_xref="taxon:10116"
                     /chromosome="X"
                     /sex="male"
                     /tissue_type="kidney, spleen, liver"
                     /geo_loc_name="USA: Wisconsin, Milwaukee"
                     /lat_lon="43.05 N 88.04 W"
                     /collected_by="Rebecca Schilling, Melinda Dwinell"
     gene            1..1258
                     /gene="Cldn34d"
                     /note="claudin 34D; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 mRNA, 3 long SRA reads,
                     2 Proteins"
                     /db_xref="GeneID:680370"
                     /db_xref="RGD:1592959"
     CDS             423..1055
                     /gene="Cldn34d"
                     /codon_start=1
                     /product="claudin 34D isoform X1"
                     /protein_id="XP_008771454.1"
                     /db_xref="GeneID:680370"
                     /db_xref="RGD:1592959"
                     /translation="
MARKHAKRQLGGFAASTIAWFLCSVSMGLPQWRVWFFQDPMESKPGMTLVGMWRTCVYHQKSNSTFNRVCYKYTYQDTFIPLDIRVAQHLLLIASLLGIISIISVIIALWKLYSGRLRKKVAFNPFRLPGILNVIASSFVLLSILYNYLSIIRKDGIAFPPSFHTPSFPDSQKVGTALAMATLSCFLFLLGGIIPLSFTLPPRCRVRYNT"
     polyA_site      1258
                     /gene="Cldn34d"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
acacctgactatgaagtcaccatccattcttgaaggacactaggggagccatattctctttagcactactggtccatctatcttcacattctgccacataaggggttacaaattcatttggagacagcattataggcaattataaattgctaataactgtttggtttggagttggaccccatgcccacctcttcttctcggatttgaggctgggtgaaactgatgattgctttgatgatgtagtttgaaagtagagtgatccagctttcatagaaggatattaaaagtgctactcctgctactatttgctgaataaattgagaaatattggcagtacacctactttgaaagatcaatagagttctgctgtgaatccatctggctcaggtttaagttgacgagagataactgtcaccgtgataatggccagaaaacatgccaagcggcaactaggaggttttgctgcaagtaccatagcatggttcctttgcagtgtctctatgggcctccctcaatggcgagtgtggttctttcaagatcccatggagtccaagcctggcatgaccttagtaggcatgtggagaacctgtgtttaccaccagaaaagtaattccacctttaacagagtgtgttacaaatacacctaccaggataccttcatccctctggatattcgagttgcccaacatctgctactcatcgcaagcctacttggcattatttccataatttccgttatcattgctctttggaaattatactcagggagactccggaagaaagtcgccttcaatccattccgccttccagggattctgaacgtcattgctagcagctttgtcttactttccatcttgtacaattatttatcgatcattcgcaaggatgggattgccttccctccatctttccacacaccctccttcccagatagtcaaaaagttggcactgcactggcaatggcaactctttcctgtttcttatttcttctaggtggtataatcccactttctttcactcttcccccacgttgccgagtgcgctataatacttaaaagtaaatttccaacttatatagacttgaaaatctaaaattaccattagaaattgcaagcactcttcaaatacctacttaaaatttccagatgaaaaaccatgcccaatgatgacaagtaggcctcctgatatttcctgtctcagttgctccatcagtttcattggcttattgattttcattaaataaaatctttcccaatta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]