ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-09-25 01:50:48, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_008773232 1258 bp mRNA linear ROD 22-FEB-2024 DEFINITION PREDICTED: Rattus norvegicus claudin 34D (Cldn34d), transcript variant X1, mRNA. ACCESSION XM_008773232 VERSION XM_008773232.4 DBLINK BioProject: PRJNA1074393 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_086039) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process On Feb 22, 2024 this sequence version replaced XM_008773232.3. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_036323735.1-RS_2024_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/09/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1258 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN/NHsdMcwi" /bio_material="RGD 61498" /db_xref="taxon:10116" /chromosome="X" /sex="male" /tissue_type="kidney, spleen, liver" /geo_loc_name="USA: Wisconsin, Milwaukee" /lat_lon="43.05 N 88.04 W" /collected_by="Rebecca Schilling, Melinda Dwinell" gene 1..1258 /gene="Cldn34d" /note="claudin 34D; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 3 long SRA reads, 2 Proteins" /db_xref="GeneID:680370" /db_xref="RGD:1592959" CDS 423..1055 /gene="Cldn34d" /codon_start=1 /product="claudin 34D isoform X1" /protein_id="XP_008771454.1" /db_xref="GeneID:680370" /db_xref="RGD:1592959" /translation="
MARKHAKRQLGGFAASTIAWFLCSVSMGLPQWRVWFFQDPMESKPGMTLVGMWRTCVYHQKSNSTFNRVCYKYTYQDTFIPLDIRVAQHLLLIASLLGIISIISVIIALWKLYSGRLRKKVAFNPFRLPGILNVIASSFVLLSILYNYLSIIRKDGIAFPPSFHTPSFPDSQKVGTALAMATLSCFLFLLGGIIPLSFTLPPRCRVRYNT"
polyA_site 1258
/gene="Cldn34d"
/experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN
acacctgactatgaagtcaccatccattcttgaaggacactaggggagccatattctctttagcactactggtccatctatcttcacattctgccacataaggggttacaaattcatttggagacagcattataggcaattataaattgctaataactgtttggtttggagttggaccccatgcccacctcttcttctcggatttgaggctgggtgaaactgatgattgctttgatgatgtagtttgaaagtagagtgatccagctttcatagaaggatattaaaagtgctactcctgctactatttgctgaataaattgagaaatattggcagtacacctactttgaaagatcaatagagttctgctgtgaatccatctggctcaggtttaagttgacgagagataactgtcaccgtgataatggccagaaaacatgccaagcggcaactaggaggttttgctgcaagtaccatagcatggttcctttgcagtgtctctatgggcctccctcaatggcgagtgtggttctttcaagatcccatggagtccaagcctggcatgaccttagtaggcatgtggagaacctgtgtttaccaccagaaaagtaattccacctttaacagagtgtgttacaaatacacctaccaggataccttcatccctctggatattcgagttgcccaacatctgctactcatcgcaagcctacttggcattatttccataatttccgttatcattgctctttggaaattatactcagggagactccggaagaaagtcgccttcaatccattccgccttccagggattctgaacgtcattgctagcagctttgtcttactttccatcttgtacaattatttatcgatcattcgcaaggatgggattgccttccctccatctttccacacaccctccttcccagatagtcaaaaagttggcactgcactggcaatggcaactctttcctgtttcttatttcttctaggtggtataatcccactttctttcactcttcccccacgttgccgagtgcgctataatacttaaaagtaaatttccaacttatatagacttgaaaatctaaaattaccattagaaattgcaagcactcttcaaatacctacttaaaatttccagatgaaaaaccatgcccaatgatgacaagtaggcctcctgatatttcctgtctcagttgctccatcagtttcattggcttattgattttcattaaataaaatctttcccaatta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]