ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-28 11:51:52, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_207586 1538 bp mRNA linear ROD 28-APR-2025
DEFINITION Rattus norvegicus chitinase, acidic (Chia), mRNA.
ACCESSION NM_207586 XM_227565
VERSION NM_207586.2
KEYWORDS RefSeq; RefSeq Select.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 1538)
AUTHORS Verwer,P.E., ten Kate,M.T., Falcone,F.H., Morroll,S.,
Verbrugh,H.A., Bakker-Woudenberg,I.A. and van de Sande,W.W.
TITLE Evidence supporting a role for mammalian chitinases in efficacy of
caspofungin against experimental aspergillosis in immunocompromised
rats
JOURNAL PLoS One 8 (10), e75848 (2013)
PUBMED 24155872
REMARK GeneRIF: Invasive pulmonary aspergillosis in immunocompromised rats
caused a dramatic increase in chitinase activity.
Publication Status: Online-Only
REFERENCE 2 (bases 1 to 1538)
AUTHORS Cho,W.S., Kim,T.H., Lee,H.M., Lee,S.H., Lee,S.H., Yoo,J.H.,
Kim,Y.S. and Lee,S.H.
TITLE Increased expression of acidic mammalian chitinase and
chitotriosidase in the nasal mucosa of patients with allergic
rhinitis
JOURNAL Laryngoscope 120 (5), 870-875 (2010)
PUBMED 20422678
REFERENCE 3 (bases 1 to 1538)
AUTHORS Wu,A.C., Lasky-Su,J., Rogers,C.A., Klanderman,B.J. and Litonjua,A.
TITLE Polymorphisms of chitinases are not associated with asthma
JOURNAL J Allergy Clin Immunol 125 (3), 754-757 (2010)
PUBMED 20226308
REFERENCE 4 (bases 1 to 1538)
AUTHORS Yang,C.J., Liu,Y.K., Liu,C.L., Shen,C.N., Kuo,M.L., Su,C.C.,
Tseng,C.P., Yen,T.C. and Shen,C.R.
TITLE Inhibition of acidic mammalian chitinase by RNA interference
suppresses ovalbumin-sensitized allergic asthma
JOURNAL Hum Gene Ther 20 (12), 1597-1606 (2009)
PUBMED 19548841
REFERENCE 5 (bases 1 to 1538)
AUTHORS Seibold,M.A., Reese,T.A., Choudhry,S., Salam,M.T., Beckman,K.,
Eng,C., Atakilit,A., Meade,K., Lenoir,M., Watson,H.G., Thyne,S.,
Kumar,R., Weiss,K.B., Grammer,L.C., Avila,P., Schleimer,R.P.,
Fahy,J.V., Rodriguez-Santana,J., Rodriguez-Cintron,W., Boot,R.G.,
Sheppard,D., Gilliland,F.D., Locksley,R.M. and Burchard,E.G.
TITLE Differential enzymatic activity of common haplotypic versions of
the human acidic Mammalian chitinase protein
JOURNAL J Biol Chem 284 (29), 19650-19658 (2009)
PUBMED 19435888
REFERENCE 6 (bases 1 to 1538)
AUTHORS Ramanathan,M. Jr., Lee,W.K. and Lane,A.P.
TITLE Increased expression of acidic mammalian chitinase in chronic
rhinosinusitis with nasal polyps
JOURNAL Am J Rhinol 20 (3), 330-335 (2006)
PUBMED 16871939
REFERENCE 7 (bases 1 to 1538)
AUTHORS Bierbaum,S., Nickel,R., Koch,A., Lau,S., Deichmann,K.A., Wahn,U.,
Superti-Furga,A. and Heinzmann,A.
TITLE Polymorphisms and haplotypes of acid mammalian chitinase are
associated with bronchial asthma
JOURNAL Am J Respir Crit Care Med 172 (12), 1505-1509 (2005)
PUBMED 16179638
REFERENCE 8 (bases 1 to 1538)
AUTHORS Zhu,Z., Zheng,T., Homer,R.J., Kim,Y.K., Chen,N.Y., Cohn,L.,
Hamid,Q. and Elias,J.A.
TITLE Acidic mammalian chitinase in asthmatic Th2 inflammation and IL-13
pathway activation
JOURNAL Science 304 (5677), 1678-1682 (2004)
PUBMED 15192232
REFERENCE 9 (bases 1 to 1538)
AUTHORS Zimmermann,N., Mishra,A., King,N.E., Fulkerson,P.C., Doepker,M.P.,
Nikolaidis,N.M., Kindinger,L.E., Moulton,E.A., Aronow,B.J. and
Rothenberg,M.E.
TITLE Transcript signatures in experimental asthma: identification of
STAT6-dependent and -independent pathways
JOURNAL J Immunol 172 (3), 1815-1824 (2004)
PUBMED 14734765
REFERENCE 10 (bases 1 to 1538)
AUTHORS Boot,R.G., Blommaart,E.F., Swart,E., Ghauharali-van der Vlugt,K.,
Bijl,N., Moe,C., Place,A. and Aerts,J.M.
TITLE Identification of a novel acidic mammalian chitinase distinct from
chitotriosidase
JOURNAL J Biol Chem 276 (9), 6770-6778 (2001)
PUBMED 11085997
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from AY486074.1.
On Aug 30, 2012 this sequence version replaced NM_207586.1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AY486074.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMN12840130, SAMN16676784
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on single protein-coding transcript
##RefSeq-Attributes-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-1538 AY486074.1 3-1540
FEATURES Location/Qualifiers
source 1..1538
/organism="Rattus norvegicus"
/mol_type="mRNA"
/strain="Sprague-Dawley"
/db_xref="taxon:10116"
/chromosome="2"
/map="2q34"
gene 1..1538
/gene="Chia"
/note="chitinase, acidic"
/db_xref="GeneID:113901"
/db_xref="RGD:1303058"
exon 1..48
/gene="Chia"
/inference="alignment:Splign:2.1.0"
CDS 24..1445
/gene="Chia"
/EC_number="3.2.1.14"
/note="eosinophil chemotactic cytokine; acidic mammalian
chitinase; AMCase; small acid mammalian chitinase"
/codon_start=1
/product="acidic mammalian chitinase precursor"
/protein_id="NP_997469.1"
/db_xref="GeneID:113901"
/db_xref="RGD:1303058"
/translation="
MAKLILVTGLVLLLNVQLGSAYNLVCYFTNWAQYRPGLGSFKPDDINPCLCTHLIYAFAGMQNNQITTIEWNDVTLYKAFNDLKNRNSKLKTLLAIGGWNFGTAPFTTMVSTSQNRQTFITSVIKFLRQYGFDGLDLDWEYPGSRGSPPQDKHLFTVLVKELREAFEQEAIESNRPRLMVTAAVAAGISNIQAGYEIPELSQYLDFIHVMTYDLHGSWDGYTGENSPLYKLPTETGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPEYGHTYILSNPSDTGIGAPTSGNGPAGPYTRQAGFWAYYEICTFLRNGATQDWDAPQEVPYAYKGNEWVGYDNIKSFSVKAQWLKQNNFGGAMIWAIDLDDFTGSFCDQGKFPLTSTLNKALDIPTAGCTAPDLPSEPVTTPPGSGSGGGSSGGGSEGSGFCAGKADGLYPVADDRNAFWHCINGITYQQHCQAGLVFDTSCNCCNWP"
sig_peptide 24..86
/gene="Chia"
/inference="COORDINATES: ab initio prediction:SignalP:6.0"
mat_peptide 87..1442
/gene="Chia"
/product="Acidic mammalian chitinase. /id=PRO_0000011946"
/note="propagated from UniProtKB/Swiss-Prot (Q6RY07.1)"
misc_feature 93..1184
/gene="Chia"
/note="This conserved domain family includes a large
number of catalytically inactive chitinase-like lectins
(chitolectins) including YKL-39, YKL-40 (HCGP39), YM1,
oviductin, and AMCase (acidic mammalian chitinase), as
well as catalytically active...; Region:
GH18_chitolectin_chitotriosidase; cd02872"
/db_xref="CDD:119351"
misc_feature order(102..104,114..116,318..323,435..437,441..446,
579..584,651..653,657..662,675..677,822..824,828..830,
912..914,1101..1103)
/gene="Chia"
/note="active site"
/db_xref="CDD:119351"
misc_feature 1206..1286
/gene="Chia"
/note="propagated from UniProtKB/Swiss-Prot (Q6RY07.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 1299..1442
/gene="Chia"
/note="Chitin-binding domain type 2; Region: ChtBD2;
smart00494"
/db_xref="CDD:214696"
exon 49..78
/gene="Chia"
/inference="alignment:Splign:2.1.0"
exon 79..280
/gene="Chia"
/inference="alignment:Splign:2.1.0"
exon 281..337
/gene="Chia"
/inference="alignment:Splign:2.1.0"
exon 338..503
/gene="Chia"
/inference="alignment:Splign:2.1.0"
exon 504..628
/gene="Chia"
/inference="alignment:Splign:2.1.0"
exon 629..752
/gene="Chia"
/inference="alignment:Splign:2.1.0"
exon 753..938
/gene="Chia"
/inference="alignment:Splign:2.1.0"
exon 939..1058
/gene="Chia"
/inference="alignment:Splign:2.1.0"
exon 1059..1200
/gene="Chia"
/inference="alignment:Splign:2.1.0"
exon 1201..1538
/gene="Chia"
/inference="alignment:Splign:2.1.0"
ORIGIN
gcgggggcagtactgaagacaacatggccaagctcattcttgtcacaggtctggttcttctgctgaatgttcagctggggtctgcctacaatctggtatgctacttcaccaactgggcccagtatcggccaggcctggggagtttcaagcctgatgacattaatccctgcctgtgtactcacctgatctatgcctttgctgggatgcagaacaatcaaatcaccaccatagaatggaatgatgttactctctataaagctttcaatgacttgaaaaacaggaacagcaaactgaaaactctcctggcaattggaggttggaactttggaactgctcctttcaccaccatggtttccacttctcagaaccgccagacctttattacctcagtcatcaaattcctgcgacagtatgggtttgatggactggacctggactgggaatacccaggttcacgtgggagccctcctcaggacaagcatctcttcactgtcctggtgaaggaactacgtgaagcttttgagcaggaggctattgagagcaacaggcccagattgatggttactgctgctgtagctgctggcatttccaacatccaggctggctacgagatccctgaactttctcagtacctggatttcatccacgtcatgacatatgacctccatggctcctgggatggctacactggggagaacagtcctctttacaaactccctactgagactggcagcaatgcctacctcaatgtggattatgtcatgaattactggaaggataatggagccccagctgagaagctcattgttggatttccagagtatggacacacctacatcctaagcaacccttctgatactggaattggtgcccctacctctggtaatggccctgctgggccctataccaggcaggctgggttctgggcctactatgagatttgtacctttctgagaaatggagccactcaggactgggatgccccccaggaagttccctatgcctacaagggcaatgagtgggttggctatgataatatcaagagcttcagtgtcaaggctcagtggcttaagcagaacaactttggtggtgccatgatctgggccattgaccttgatgacttcactggctctttctgtgaccagggaaaattccctctgacttctactttgaataaagcccttgatatacccacagcaggttgcacagcccctgacttaccttctgaaccagtaactactcctccaggaagtgggagtggtggtggaagctctggtggaggttctgaaggcagtggattctgtgctggcaaagcagatggcctctaccctgtggcagatgacagaaatgctttctggcactgcatcaatggaatcacatatcagcagcattgtcaggcagggttagtttttgataccagctgtaattgctgcaactggccatgaaactaatgttcttcacgaaatttctgccttctcccttaatcctcaccaaaggtagcttgcttccatttaaagttatgcaataaaattgatagc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]