2024-04-27 14:06:11, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_173120 1173 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus selenoprotein S (Selenos), mRNA. ACCESSION NM_173120 VERSION NM_173120.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1173) AUTHORS Hughes DJ, Kunicka T, Schomburg L, Liska V, Swan N and Soucek P. TITLE Expression of Selenoprotein Genes and Association with Selenium Status in Colorectal Adenoma and Colorectal Cancer JOURNAL Nutrients 10 (11), 1812 (2018) PUBMED 30469315 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1173) AUTHORS Gladyshev VN, Arner ES, Berry MJ, Brigelius-Flohe R, Bruford EA, Burk RF, Carlson BA, Castellano S, Chavatte L, Conrad M, Copeland PR, Diamond AM, Driscoll DM, Ferreiro A, Flohe L, Green FR, Guigo R, Handy DE, Hatfield DL, Hesketh J, Hoffmann PR, Holmgren A, Hondal RJ, Howard MT, Huang K, Kim HY, Kim IY, Kohrle J, Krol A, Kryukov GV, Lee BJ, Lee BC, Lei XG, Liu Q, Lescure A, Lobanov AV, Loscalzo J, Maiorino M, Mariotti M, Sandeep Prabhu K, Rayman MP, Rozovsky S, Salinas G, Schmidt EE, Schomburg L, Schweizer U, Simonovic M, Sunde RA, Tsuji PA, Tweedie S, Ursini F, Whanger PD and Zhang Y. TITLE Selenoprotein Gene Nomenclature JOURNAL J Biol Chem 291 (46), 24036-24040 (2016) PUBMED 27645994 REFERENCE 3 (bases 1 to 1173) AUTHORS Ye Y, Fu F, Li X, Yang J and Liu H. TITLE Selenoprotein S Is Highly Expressed in the Blood Vessels and Prevents Vascular Smooth Muscle Cells From Apoptosis JOURNAL J Cell Biochem 117 (1), 106-117 (2016) PUBMED 26058460 REMARK GeneRIF: Selenoprotein S Is Highly Expressed in the Blood Vessels and Prevents Vascular Smooth Muscle Cells From Apoptosis REFERENCE 4 (bases 1 to 1173) AUTHORS Liu Y, Soetandyo N, Lee JG, Liu L, Xu Y, Clemons WM Jr and Ye Y. TITLE USP13 antagonizes gp78 to maintain functionality of a chaperone in ER-associated degradation JOURNAL Elife 3, e01369 (2014) PUBMED 24424410 REFERENCE 5 (bases 1 to 1173) AUTHORS Bubenik JL, Miniard AC and Driscoll DM. TITLE Alternative transcripts and 3'UTR elements govern the incorporation of selenocysteine into selenoprotein S JOURNAL PLoS One 8 (4), e62102 (2013) PUBMED 23614019 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1173) AUTHORS Curran JE, Jowett JB, Elliott KS, Gao Y, Gluschenko K, Wang J, Abel Azim DM, Cai G, Mahaney MC, Comuzzie AG, Dyer TD, Walder KR, Zimmet P, MacCluer JW, Collier GR, Kissebah AH and Blangero J. TITLE Genetic variation in selenoprotein S influences inflammatory response JOURNAL Nat Genet 37 (11), 1234-1241 (2005) PUBMED 16227999 REFERENCE 7 (bases 1 to 1173) AUTHORS Ye Y, Shibata Y, Yun C, Ron D and Rapoport TA. TITLE A membrane protein complex mediates retro-translocation from the ER lumen into the cytosol JOURNAL Nature 429 (6994), 841-847 (2004) PUBMED 15215856 REFERENCE 8 (bases 1 to 1173) AUTHORS Gao Y, Feng HC, Walder K, Bolton K, Sunderland T, Bishara N, Quick M, Kantham L and Collier GR. TITLE Regulation of the selenoprotein SelS by glucose deprivation and endoplasmic reticulum stress - SelS is a novel glucose-regulated protein JOURNAL FEBS Lett 563 (1-3), 185-190 (2004) PUBMED 15063746 REFERENCE 9 (bases 1 to 1173) AUTHORS Kryukov GV, Castellano S, Novoselov SV, Lobanov AV, Zehtab O, Guigo R and Gladyshev VN. TITLE Characterization of mammalian selenoproteomes JOURNAL Science 300 (5624), 1439-1443 (2003) PUBMED 12775843 REFERENCE 10 (bases 1 to 1173) AUTHORS Walder K, Kantham L, McMillan JS, Trevaskis J, Kerr L, De Silva A, Sunderland T, Godde N, Gao Y, Bishara N, Windmill K, Tenne-Brown J, Augert G, Zimmet PZ and Collier GR. TITLE Tanis: a link between type 2 diabetes and inflammation? JOURNAL Diabetes 51 (6), 1859-1866 (2002) PUBMED 12031974 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BC059111.1 and AF367467.1. On Aug 2, 2006 this sequence version replaced NM_173120.1. Summary: This gene encodes a transmembrane protein that is localized in the endoplasmic reticulum (ER). It is involved in the degradation process of misfolded proteins in the ER, and may also have a role in inflammation control. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec). Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Two additional phylogenetically conserved stem-loop structures (Stem-loop 1 and Stem-loop 2) in the 3' UTR of this mRNA have been shown to function as modulators of Sec insertion (PMID:23614019). [provided by RefSeq, Jul 2017]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF367467.1, FQ218853.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00132261, SAMD00132262 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## protein contains selenocysteine :: inferred from conservation RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-945 BC059111.1 5-949 946-1173 AF367467.1 956-1183 FEATURES Location/Qualifiers source 1..1173 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="1" /map="1q22" gene 1..1173 /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" /note="selenoprotein S" /db_xref="GeneID:286900" /db_xref="RGD:628897" exon 1..104 /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" /inference="alignment:Splign:2.1.0" misc_feature 8..10 /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" /note="upstream in-frame stop codon" CDS 29..601 /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" /note="UGA stop codon recoded as selenocysteine; Tanis; VCP-interacting membrane protein; VCP-interacting membrane selenoprotein" /codon_start=1 /transl_except=(pos:593..595,aa:Sec) /product="selenoprotein S" /protein_id="NP_775143.2" /db_xref="GeneID:286900" /db_xref="RGD:628897" /translation="
MDRGEEPLSARPALETESLRFLHVTVGSLLASYGWYILFSCVLLYIVIQKLSLRLRALRQRQLDQAEAVLEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKLRQLEEEKRRQKIEMWDSMQEGRSYKRNSGRPQEEDGPGPSTSSVIPKGKSDKKPLRGGGYNPLTGEGGGTCSWRPGRRGPSSGGUS"
misc_feature 29..592 /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" /note="Selenoprotein S (SelS); Region: Selenoprotein_S; pfam06936" /db_xref="CDD:429198" misc_feature 110..172 /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" /note="propagated from UniProtKB/Swiss-Prot (Q8VHV8.3); transmembrane region" misc_feature 260..298 /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" /note="propagated from UniProtKB/Swiss-Prot (Q8VHV8.3); Region: VCP/p97-interacting motif (VIM). /evidence=ECO:0000250|UniProtKB:Q9BQE4" misc_feature 311..598 /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" /note="propagated from UniProtKB/Swiss-Prot (Q8VHV8.3); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 593..595 /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" /note="Selenocysteine; other site" exon 105..239 /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" /inference="alignment:Splign:2.1.0" exon 240..346 /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" /inference="alignment:Splign:2.1.0" exon 347..436 /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" /inference="alignment:Splign:2.1.0" exon 437..515 /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" /inference="alignment:Splign:2.1.0" exon 516..1146 /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" /inference="alignment:Splign:2.1.0" regulatory 604..636 /regulatory_class="recoding_stimulatory_region" /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" /note="Stem-loop 1" /function="promotes selenocysteine insertion" regulatory 909..996 /regulatory_class="recoding_stimulatory_region" /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" /note="SECIS_element" /function="essential for recoding UGA to specify selenocysteine" regulatory 1001..1027 /regulatory_class="other" /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" /note="recoding_inhibitory_region; Stem-loop 2" /function="inhibits selenocysteine insertion" regulatory 1082..1087 /regulatory_class="polyA_signal_sequence" /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" polyA_site 1101 /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" polyA_site 1146 /gene="Selenos" /gene_synonym="Sels; sg2; Vimp" ORIGIN
gaagggctagtcgttggcggccgcagccatggatcgcggggaggaacctctgtccgcgaggccggcgctggagaccgagagcctgcgattcctgcacgtcacagtgggctccctgctggccagctatggctggtacatcctcttcagctgcgtccttctctacattgtcatccagaagctctccctgcgactgagggctttaaggcagaggcagctggaccaagctgaggctgttctggagcctgatgttgttgttaagcgacaagaggctttagcagctgctcgtttgagaatgcaggaagatctgaatgcccaagttgaaaaacataaggaaaaactaagacagcttgaagaagagaaaaggagacagaagattgaaatgtgggacagcatgcaagaaggcagaagttacaaaagaaactcaggaaggcctcaggaagaagatggtcctggaccttctacttcatcggtcatccccaaaggaaaatctgacaaaaagcctttacggggaggtggttataaccctctgacaggtgaagggggtggaacctgctcctggagacctggacgcaggggcccatcatctggtggatgaagctaagactcttgttagtgtcgctttgacattagcaaggtgaacccttaaccctcaactcaattgccttacgcacactttcacagtgactggccaaggagaggtagggctgatttctgttctgaacacctcatattttaagggctttggtcatagacattgccactaggccacactctagacgagacagctattggttttgtggccacttgctagtcagtaggttggaggcttcttgctgtttctcagacttcatcgaggaggcccagtgatggccctttggggcagaagtccttgatgacagacagggtggtctctgtgacaggatgcgttgaatgatgtcttccttataaatggtgagcccaccagtgaggattactgatgtacacagttgatggggtttgcttctgtatatttattttatgtacagaactttgtaaaaaaaaaaaagttaactacttaaaaagtaacatttttagcatctttattaaactcaaggaaatttctttgtgagcttgactttgtcagacagtaaacagctttttatcagtaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]