LOCUS       NM_057129                463 bp    mRNA    linear   ROD 20-NOV-2023
DEFINITION  Rattus norvegicus trefoil factor 1 (Tff1), mRNA.
ACCESSION   NM_057129
VERSION     NM_057129.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 463)
  AUTHORS   Esposito R, Morello S, Vllahu M, Eletto D, Porta A and Tosco A.
  TITLE     Gastric TFF1 Expression from Acute to Chronic Helicobacter
            Infection
  JOURNAL   Front Cell Infect Microbiol 7, 434 (2017)
   PUBMED   29085807
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 463)
  AUTHORS   Jensen P, Ducray AD, Widmer HR and Meyer M.
  TITLE     Effects of Forskolin on Trefoil factor 1 expression in cultured
            ventral mesencephalic dopaminergic neurons
  JOURNAL   Neuroscience 310, 699-708 (2015)
   PUBMED   26459015
  REMARK    GeneRIF: Distinct populations of cultured dopaminergic neurons
            express trefoil factor 1, and their numbers can be increased by
            factors known to influence survival and differentiation of
            dopaminergic cells.
REFERENCE   3  (bases 1 to 463)
  AUTHORS   Wu JF, Zhang J, Xue G and Zhang HQ.
  TITLE     Expression and localization of trefoil factor family genes in rat
            submandibular glands
  JOURNAL   Biotech Histochem 89 (6), 424-432 (2014)
   PUBMED   24588600
  REMARK    GeneRIF: Substantial amounts of TFF1 were detected only in the
            cytoplasm of epithelial cells in the submandibular glands granular
            convoluted tubules (GCT), while TFF2 and TFF3 were widely
            distributed in the cytoplasm of epithelial cells of intercalated
            ducts
REFERENCE   4  (bases 1 to 463)
  AUTHORS   Jensen P, Heimberg M, Ducray AD, Widmer HR and Meyer M.
  TITLE     Expression of trefoil factor 1 in the developing and adult rat
            ventral mesencephalon
  JOURNAL   PLoS One 8 (10), e76592 (2013)
   PUBMED   24116124
  REMARK    GeneRIF: Data indicate that trefoil factor 1 (TFF1) expression is
            restricted to neurons.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 463)
  AUTHORS   Fu T, Kalbacher H and Hoffmann W.
  TITLE     TFF1 is differentially expressed in stationary and migratory rat
            gastric epithelial cells (RGM-1) after in vitro wounding: influence
            of TFF1 RNA interference on cell migration
  JOURNAL   Cell Physiol Biochem 32 (4), 997-1010 (2013)
   PUBMED   24107452
  REMARK    GeneRIF: Tff1 expression was up-regulated in migratory cells. No
            unequivocal signs of the epithelial-mesenchymal transition were
            detectable in migratory cells. Transfection of RGM-1 cells with
            Tff1-siRNAi duplexes negatively influenced migration of these
            cells.
REFERENCE   6  (bases 1 to 463)
  AUTHORS   Koshiyama M, Yoshida M, Konishi M, Takemura M, Yura Y, Matsushita
            K, Hayashi M and Tauchi K.
  TITLE     Expression of pS2 protein in endometrial carcinomas: correlation
            with clinicopathologic features and sex steroid receptor status
  JOURNAL   Int J Cancer 74 (3), 237-244 (1997)
   PUBMED   9221798
REFERENCE   7  (bases 1 to 463)
  AUTHORS   Speiser P, Mayerhofer K, Kucera E, Roch G, Mittelbock M, Gitsch G
            and Zeillinger R.
  TITLE     pS2 and PAI-1 in ovarian cancer: correlation to pathohistological
            parameters
  JOURNAL   Anticancer Res 17 (1B), 679-683 (1997)
   PUBMED   9066601
REFERENCE   8  (bases 1 to 463)
  AUTHORS   Lefebvre O, Chenard MP, Masson R, Linares J, Dierich A, LeMeur M,
            Wendling C, Tomasetto C, Chambon P and Rio MC.
  TITLE     Gastric mucosa abnormalities and tumorigenesis in mice lacking the
            pS2 trefoil protein
  JOURNAL   Science 274 (5285), 259-262 (1996)
   PUBMED   8824193
REFERENCE   9  (bases 1 to 463)
  AUTHORS   Itoh H, Tomita M, Uchino H, Kobayashi T, Kataoka H, Sekiya R and
            Nawa Y.
  TITLE     cDNA cloning of rat pS2 peptide and expression of trefoil peptides
            in acetic acid-induced colitis
  JOURNAL   Biochem J 318 (Pt 3) (Pt 3), 939-944 (1996)
   PUBMED   8836141
REFERENCE   10 (bases 1 to 463)
  AUTHORS   Lipponen PK and Eskelinen MJ.
  TITLE     Expression of pS2 protein in transitional cell bladder tumours
  JOURNAL   J Pathol 173 (4), 327-332 (1994)
   PUBMED   7965392
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from
            JACYVU010000324.1.
            
            On Nov 27, 2020 this sequence version replaced NM_057129.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: D83231.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5756307, SAMN09345238
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-105               JACYVU010000324.1  4963371-4963475     c
            106-258             JACYVU010000324.1  4960891-4961043     c
            259-463             JACYVU010000324.1  4959614-4959818     c
FEATURES             Location/Qualifiers
     source          1..463
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="20"
                     /map="20p12"
     gene            1..463
                     /gene="Tff1"
                     /gene_synonym="Ps2"
                     /note="trefoil factor 1"
                     /db_xref="GeneID:117270"
                     /db_xref="RGD:620707"
     exon            1..105
                     /gene="Tff1"
                     /gene_synonym="Ps2"
                     /inference="alignment:Splign:2.1.0"
     CDS             30..275
                     /gene="Tff1"
                     /gene_synonym="Ps2"
                     /note="protein pS2"
                     /codon_start=1
                     /product="trefoil factor 1 precursor"
                     /protein_id="NP_476470.1"
                     /db_xref="GeneID:117270"
                     /db_xref="RGD:620707"
                     /translation="

MEHKVTCVLAMVLMLALSSLAQNQEETCAVIPRERINCGFPGVTAQQCKEKGCCFDDSVRGFPWCFRPLVIENQQEEECPF"

     sig_peptide     30..92
                     /gene="Tff1"
                     /gene_synonym="Ps2"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     mat_peptide     93..272
                     /gene="Tff1"
                     /gene_synonym="Ps2"
                     /product="Trefoil factor 1. /id=PRO_0000023458"
                     /note="propagated from UniProtKB/Swiss-Prot (Q63467.1)"
     misc_feature    93..95
                     /gene="Tff1"
                     /gene_synonym="Ps2"
                     /note="Pyrrolidone carboxylic acid. /evidence=ECO:0000255;
                     propagated from UniProtKB/Swiss-Prot (Q63467.1);
                     pyrrolidone-carboxylic-acid site"
     misc_feature    105..233
                     /gene="Tff1"
                     /gene_synonym="Ps2"
                     /note="P or trefoil or TFF domain; Region: PD; smart00018"
                     /db_xref="CDD:197472"
     misc_feature    order(150..152,216..221)
                     /gene="Tff1"
                     /gene_synonym="Ps2"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238059"
     misc_feature    order(195..197,216..218)
                     /gene="Tff1"
                     /gene_synonym="Ps2"
                     /note="putative binding specificity loop [active]"
                     /db_xref="CDD:238059"
     exon            106..258
                     /gene="Tff1"
                     /gene_synonym="Ps2"
                     /inference="alignment:Splign:2.1.0"
     exon            259..463
                     /gene="Tff1"
                     /gene_synonym="Ps2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

atcactcgtggtcttccctggaagctgccatggagcacaaggtgacctgtgtcctcgccatggtcctcatgctggctctcagcagccttgcccagaaccaggaagaaacatgtgccgtgatcccccgggagagaataaattgtggcttccccggtgtcaccgcccagcagtgcaaggaaaagggttgctgttttgatgacagtgtccgggggttcccatggtgcttccgacctctggtcattgagaaccagcaagaagaagaatgtcccttctaaggtccatccgagagaactggttacatcaagactcggcaccccctcccccaaacctggaccctggagccacctggcccacctgcttcatacacacctgttcggtggctggatctggcctggtgacacagttcaacctctcagacttttaaccctcaaattcggcctgattattaaaagatatgaatgct

//