2024-05-02 06:58:30, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_031318 698 bp mRNA linear ROD 05-MAY-2023 DEFINITION Rattus norvegicus dynein light chain Tctex-type 1 (Dynlt1), mRNA. ACCESSION NM_031318 VERSION NM_031318.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 698) AUTHORS Asante D, Stevenson NL and Stephens DJ. TITLE Subunit composition of the human cytoplasmic dynein-2 complex JOURNAL J Cell Sci 127 (Pt 21), 4774-4787 (2014) PUBMED 25205765 REFERENCE 2 (bases 1 to 698) AUTHORS Ribeiro FM, Devries RA, Hamilton A, Guimaraes IM, Cregan SP, Pires RG and Ferguson SS. TITLE Metabotropic glutamate receptor 5 knockout promotes motor and biochemical alterations in a mouse model of Huntington's disease JOURNAL Hum Mol Genet 23 (8), 2030-2042 (2014) PUBMED 24282028 REFERENCE 3 (bases 1 to 698) AUTHORS Xu X, Zhang Q, Hu JY, Zhang DX, Jiang XP, Jia JZ, Zhu JC and Huang YS. TITLE Phosphorylation of DYNLT1 at serine 82 regulates microtubule stability and mitochondrial permeabilization in hypoxia JOURNAL Mol Cells 36 (4), 322-332 (2013) PUBMED 24170091 REMARK GeneRIF: Data suggest that DYNLT1 phosphorylation at serine S82 is involved in microtubule and mitochondria regulation, and their interaction and cooperation contribute to the cellular hypoxic tolerance. REFERENCE 4 (bases 1 to 698) AUTHORS Allan VJ. TITLE Cytoplasmic dynein JOURNAL Biochem Soc Trans 39 (5), 1169-1178 (2011) PUBMED 21936784 REMARK Review article REFERENCE 5 (bases 1 to 698) AUTHORS Fang YD, Xu X, Dang YM, Zhang YM, Zhang JP, Hu JY, Zhang Q, Dai X, Teng M, Zhang DX and Huang YS. TITLE MAP4 mechanism that stabilizes mitochondrial permeability transition in hypoxia: microtubule enhancement and DYNLT1 interaction with VDAC1 JOURNAL PLoS One 6 (12), e28052 (2011) PUBMED 22164227 REMARK GeneRIF: there are two possible mechanisms triggered by MAP4: stabilization of MT networks; DYNLT1 modulation, which is connected with VDAC1, and inhibition of hypoxia-induced mitochondrial permeabilization REFERENCE 6 (bases 1 to 698) AUTHORS Yagil C, Hubner N, Monti J, Schulz H, Sapojnikov M, Luft FC, Ganten D and Yagil Y. TITLE Identification of hypertension-related genes through an integrated genomic-transcriptomic approach JOURNAL Circ Res 96 (6), 617-625 (2005) PUBMED 15731461 REFERENCE 7 (bases 1 to 698) AUTHORS Ligon LA, Tokito M, Finklestein JM, Grossman FE and Holzbaur EL. TITLE A direct interaction between cytoplasmic dynein and kinesin I may coordinate motor activity JOURNAL J Biol Chem 279 (18), 19201-19208 (2004) PUBMED 14985359 REFERENCE 8 (bases 1 to 698) AUTHORS Malik-Hall M, Poon WY, Baker MD, Wood JN and Okuse K. TITLE Sensory neuron proteins interact with the intracellular domains of sodium channel NaV1.8 JOURNAL Brain Res Mol Brain Res 110 (2), 298-304 (2003) PUBMED 12591166 REFERENCE 9 (bases 1 to 698) AUTHORS Tai AW, Chuang JZ, Bode C, Wolfrum U and Sung CH. TITLE Rhodopsin's carboxy-terminal cytoplasmic tail acts as a membrane receptor for cytoplasmic dynein by binding to the dynein light chain Tctex-1 JOURNAL Cell 97 (7), 877-887 (1999) PUBMED 10399916 REFERENCE 10 (bases 1 to 698) AUTHORS Nagano F, Orita S, Sasaki T, Naito A, Sakaguchi G, Maeda M, Watanabe T, Kominami E, Uchiyama Y and Takai Y. TITLE Interaction of Doc2 with tctex-1, a light chain of cytoplasmic dynein. Implication in dynein-dependent vesicle transport JOURNAL J Biol Chem 273 (46), 30065-30068 (1998) PUBMED 9804756 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AJ131437.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AJ131437.1, BC166879.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5760383, SAMEA5760389 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..698 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="1" /map="1q11" gene 1..698 /gene="Dynlt1" /gene_synonym="AGS2; Tctex1" /note="dynein light chain Tctex-type 1" /db_xref="GeneID:83462" /db_xref="RGD:620261" exon 1..41 /gene="Dynlt1" /gene_synonym="AGS2; Tctex1" /inference="alignment:Splign:2.1.0" CDS 15..356 /gene="Dynlt1" /gene_synonym="AGS2; Tctex1" /note="T-complex testis-specific protein 1 homolog; activator of G-protein signaling 2; t-complex testis expressed 1" /codon_start=1 /product="dynein light chain Tctex-type 1" /protein_id="NP_112608.1" /db_xref="GeneID:83462" /db_xref="RGD:620261" /translation="
MEDFQASEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI"
misc_feature 15..17 /gene="Dynlt1" /gene_synonym="AGS2; Tctex1" /note="N-acetylmethionine. /evidence=ECO:0000250|UniProtKB:P63172; propagated from UniProtKB/Swiss-Prot (Q9Z336.1); acetylation site" misc_feature 48..353 /gene="Dynlt1" /gene_synonym="AGS2; Tctex1" /note="dynein light chain (DLC)-like domain found in dynein light chain Tctex-type 1 (DYNLT1) and similar proteins; Region: DLC-like_DYNLT1; cd21462" /db_xref="CDD:412010" misc_feature 135..353 /gene="Dynlt1" /gene_synonym="AGS2; Tctex1" /note="propagated from UniProtKB/Swiss-Prot (Q9Z336.1); Region: Interaction with GNB1. /evidence=ECO:0000269|PubMed:17491591" misc_feature order(198..200,204..224,234..266,270..272,282..284, 339..341,345..347) /gene="Dynlt1" /gene_synonym="AGS2; Tctex1" /note="homodimer interface [polypeptide binding]; other site" /db_xref="CDD:412010" exon 42..83 /gene="Dynlt1" /gene_synonym="AGS2; Tctex1" /inference="alignment:Splign:2.1.0" exon 84..207 /gene="Dynlt1" /gene_synonym="AGS2; Tctex1" /inference="alignment:Splign:2.1.0" exon 208..285 /gene="Dynlt1" /gene_synonym="AGS2; Tctex1" /inference="alignment:Splign:2.1.0" exon 286..698 /gene="Dynlt1" /gene_synonym="AGS2; Tctex1" /inference="alignment:Splign:2.1.0" ORIGIN
gcgctagagggaagatggaagacttccaggcctccgaggagactgcatttgttgtggatgaagtgagcaacattgtaaaggaggctatagaaagtgccatcggcggtaacgcctaccagcacagcaaagtcaaccagtggaccactaatgttgtagaacagactttgagccaactcaccaaactggggaaaccatttaaatacattgtgacctgtgtgatcatgcagaagaatggtgctgggttacacaccgcaagttcctgcttctgggacagctccacggacgggagctgcacagtccgatgggagaacaagaccatgtactgcatcgtcagtgccttcggactgtccatctgaccgcctgactgcctcagcctccggttccagcgtttctagtccatcttaccaccagctatgttgggcggataccttcctcctctttaagttgttctgaggcactcccaaaatgtagagaaataaaccaaatgaccctggccacaggaaccacacgacggacactaggcagatgagcagccacctgtcatccaaggcaggcagtaccagttgtcttaactgtcttctcaaaggtgctaagatctcaagtctgctagtggaaacttctctactttctgaaatgattcagatacactaattttccacactttatacttttgttagaataataaattattcagaatt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]