ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-07-04 07:13:29, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001430109 775 bp mRNA linear ROD 05-MAY-2025
DEFINITION Rattus norvegicus nucleophosmin 1 (Npm1), transcript variant 3,
mRNA.
ACCESSION NM_001430109
VERSION NM_001430109.1
KEYWORDS RefSeq.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 775)
AUTHORS Pfister,J.A. and D'Mello,S.R.
TITLE Regulation of Neuronal Survival by Nucleophosmin 1 (NPM1) Is
Dependent on Its Expression Level, Subcellular Localization, and
Oligomerization Status
JOURNAL J Biol Chem 291 (39), 20787-20797 (2016)
PUBMED 27510036
REMARK GeneRIF: study suggests that although neurons need NPM1 for
survival, an increase in its expression beyond physiological levels
and its translocation to the cytoplasm leads to death through
abortive cell cycle induction.
REFERENCE 2 (bases 1 to 775)
AUTHORS Kim,J.Y., Cho,Y.E. and Park,J.H.
TITLE The Nucleolar Protein GLTSCR2 Is an Upstream Negative Regulator of
the Oncogenic Nucleophosmin-MYC Axis
JOURNAL Am J Pathol 185 (7), 2061-2068 (2015)
PUBMED 25956029
REFERENCE 3 (bases 1 to 775)
AUTHORS Kuzelova,K., Brodska,B., Fuchs,O., Dobrovolna,M., Soukup,P. and
Cetkovsky,P.
TITLE Altered HLA Class I Profile Associated with Type A/D Nucleophosmin
Mutation Points to Possible Anti-Nucleophosmin Immune Response in
Acute Myeloid Leukemia
JOURNAL PLoS One 10 (5), e0127637 (2015)
PUBMED 25992555
REMARK Publication Status: Online-Only
REFERENCE 4 (bases 1 to 775)
AUTHORS Milochau,A., Lagree,V., Benassy,M.N., Chaignepain,S., Papin,J.,
Garcia-Arcos,I., Lajoix,A., Monterrat,C., Coudert,L.,
Schmitter,J.M., Ochoa,B. and Lang,J.
TITLE Synaptotagmin 11 interacts with components of the RNA-induced
silencing complex RISC in clonal pancreatic beta-cells
JOURNAL FEBS Lett 588 (14), 2217-2222 (2014)
PUBMED 24882364
REFERENCE 5 (bases 1 to 775)
AUTHORS Mitrea,D.M., Grace,C.R., Buljan,M., Yun,M.K., Pytel,N.J.,
Satumba,J., Nourse,A., Park,C.G., Madan Babu,M., White,S.W. and
Kriwacki,R.W.
TITLE Structural polymorphism in the N-terminal oligomerization domain of
NPM1
JOURNAL Proc Natl Acad Sci U S A 111 (12), 4466-4471 (2014)
PUBMED 24616519
REFERENCE 6 (bases 1 to 775)
AUTHORS Takemura,M., Ohta,N., Furuichi,Y., Takahashi,T., Yoshida,S.,
Olson,M.O. and Umekawa,H.
TITLE Stimulation of calf thymus DNA polymerase alpha activity by
nucleolar protein B23
JOURNAL Biochem Biophys Res Commun 199 (1), 46-51 (1994)
PUBMED 8123045
REFERENCE 7 (bases 1 to 775)
AUTHORS Biggiogera,M., Burki,K., Kaufmann,S.H., Shaper,J.H., Gas,N.,
Amalric,F. and Fakan,S.
TITLE Nucleolar distribution of proteins B23 and nucleolin in mouse
preimplantation embryos as visualized by immunoelectron microscopy
JOURNAL Development 110 (4), 1263-1270 (1990)
PUBMED 2100262
REFERENCE 8 (bases 1 to 775)
AUTHORS Chang,J.H. and Olson,M.O.
TITLE Structure of the gene for rat nucleolar protein B23
JOURNAL J Biol Chem 265 (30), 18227-18233 (1990)
PUBMED 2211699
REFERENCE 9 (bases 1 to 775)
AUTHORS Chang,J.H. and Olson,M.O.
TITLE A single gene codes for two forms of rat nucleolar protein B23 mRNA
JOURNAL J Biol Chem 264 (20), 11732-11737 (1989)
PUBMED 2745414
REFERENCE 10 (bases 1 to 775)
AUTHORS Chang,J.H., Dumbar,T.S. and Olson,M.O.
TITLE cDNA and deduced primary structure of rat protein B23, a nucleolar
protein containing highly conserved sequences
JOURNAL J Biol Chem 263 (26), 12824-12827 (1988)
PUBMED 3417636
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
JAXUCZ010000010.1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: FM117958.1, FQ112496.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMN12840108, SAMN16676784
[ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-151 JAXUCZ010000010.1 18255591-18255741 c
152-231 JAXUCZ010000010.1 18254068-18254147 c
232-351 JAXUCZ010000010.1 18253666-18253785 c
352-445 JAXUCZ010000010.1 18253373-18253466 c
446-552 JAXUCZ010000010.1 18252863-18252969 c
553-775 JAXUCZ010000010.1 18252526-18252748 c
FEATURES Location/Qualifiers
source 1..775
/organism="Rattus norvegicus"
/mol_type="mRNA"
/strain="BN"
/db_xref="taxon:10116"
/chromosome="10"
/map="10q12"
gene 1..775
/gene="Npm1"
/gene_synonym="B23NP"
/note="nucleophosmin 1"
/db_xref="GeneID:25498"
/db_xref="RGD:3192"
exon 1..151
/gene="Npm1"
/gene_synonym="B23NP"
/inference="alignment:Splign:2.1.0"
CDS 94..618
/gene="Npm1"
/gene_synonym="B23NP"
/note="isoform 3 is encoded by transcript variant 3;
nucleolar protein B23.1; NPM; numatrin; nucleolar protein
NO38; nucleolar phosphoprotein B23; nucleophosmin
(nucleolar phosphoprotein B23, numatrin)"
/codon_start=1
/product="nucleophosmin isoform 3"
/protein_id="NP_001417038.1"
/db_xref="GeneID:25498"
/db_xref="RGD:3192"
/translation="
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDDEDDEDDEDDEE"
misc_feature 94..444
/gene="Npm1"
/gene_synonym="B23NP"
/note="propagated from UniProtKB/Swiss-Prot (P13084.1);
Region: Necessary for interaction with APEX1.
/evidence=ECO:0000250"
misc_feature 94..96
/gene="Npm1"
/gene_synonym="B23NP"
/note="N-acetylmethionine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (P13084.1); acetylation site"
misc_feature 103..105
/gene="Npm1"
/gene_synonym="B23NP"
/note="Phosphoserine, by PLK1 and PLK2.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
misc_feature 121..123
/gene="Npm1"
/gene_synonym="B23NP"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
misc_feature 145..444
/gene="Npm1"
/gene_synonym="B23NP"
/note="Nucleoplasmin/nucleophosmin domain; Region:
Nucleoplasmin; pfam03066"
/db_xref="CDD:460792"
misc_feature 187..189
/gene="Npm1"
/gene_synonym="B23NP"
/note="N6-acetyllysine, alternate.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (P13084.1); acetylation site"
misc_feature 220..222
/gene="Npm1"
/gene_synonym="B23NP"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
misc_feature 256..258
/gene="Npm1"
/gene_synonym="B23NP"
/note="Interaction between pentamers.
/evidence=ECO:0000250; propagated from
UniProtKB/Swiss-Prot (P13084.1); other site"
misc_feature 292..294
/gene="Npm1"
/gene_synonym="B23NP"
/note="Phosphotyrosine.
/evidence=ECO:0000250|UniProtKB:Q61937; propagated from
UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
misc_feature 301..303
/gene="Npm1"
/gene_synonym="B23NP"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
misc_feature 316..318
/gene="Npm1"
/gene_synonym="B23NP"
/note="Phosphothreonine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
misc_feature 331..333
/gene="Npm1"
/gene_synonym="B23NP"
/note="Interaction between pentamers.
/evidence=ECO:0000250; propagated from
UniProtKB/Swiss-Prot (P13084.1); other site"
misc_feature 376..378
/gene="Npm1"
/gene_synonym="B23NP"
/note="Phosphothreonine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
misc_feature 466..468
/gene="Npm1"
/gene_synonym="B23NP"
/note="Phosphoserine, by CDK2.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
misc_feature 508..510
/gene="Npm1"
/gene_synonym="B23NP"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (P13084.1); phosphorylation site"
misc_feature 541..543
/gene="Npm1"
/gene_synonym="B23NP"
/note="N6-acetyllysine, alternate.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (P13084.1); acetylation site"
misc_feature 547..564
/gene="Npm1"
/gene_synonym="B23NP"
/note="propagated from UniProtKB/Swiss-Prot (P13084.1);
Region: Nuclear localization signal.
/evidence=ECO:0000255"
misc_feature 553..555
/gene="Npm1"
/gene_synonym="B23NP"
/note="N6-acetyllysine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (P13084.1); acetylation site"
exon 152..231
/gene="Npm1"
/gene_synonym="B23NP"
/inference="alignment:Splign:2.1.0"
exon 232..351
/gene="Npm1"
/gene_synonym="B23NP"
/inference="alignment:Splign:2.1.0"
exon 352..445
/gene="Npm1"
/gene_synonym="B23NP"
/inference="alignment:Splign:2.1.0"
exon 446..552
/gene="Npm1"
/gene_synonym="B23NP"
/inference="alignment:Splign:2.1.0"
exon 553..775
/gene="Npm1"
/gene_synonym="B23NP"
/inference="alignment:Splign:2.1.0"
ORIGIN
ggcgtgattccgtcctgcgtgtctgttctgcggaacagtaggcagttgttttccgtccggcttctctcacactcaagtgcgcgcctccacctcatggaagactcgatggacatggacatgagccctcttaggcctcagaactaccttttcggttgtgaactaaaggctgacaaagattatcactttaaagtggataatgatgaaaatgagcaccagttatcattaagaacggtcagtttaggagcaggggcaaaagatgagttgcacatcgtagaggcagaagcaatgaactatgaaggcagcccaattaaagtaacactggcaactttgaaaatgtctgtacaaccaacagtttcccttgggggcttcgaaattacaccacctgtggtcttgaggttgaagtgtggttctgggcctgtgcacataagtggacagcacctagtagctgtagaggaagatgcagagtcagaagatgaagatgaggaagatgtaaaactcttaggcatgtctggaaagagatctgctcccggaggtggtaacaaagtcccacagaaaaaagtaaaacttgatgaagatgatgatgaggatgatgaagatgatgaggatgatgaagagtaagtagtatgagtaatatgatctcagaaatttgatagtacatgtacttgtaaaggttttaggaggactgatttgccagtgggttctgtaaaagtaatcagtggttgatgtttggaaggaagtaaaggtttttgtaacaataaaggatttcgcattatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]