GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-08 05:35:03, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001399252            1620 bp    mRNA    linear   ROD 23-MAR-2023
DEFINITION  Rattus norvegicus angiopoietin-like 3 (Angptl3), transcript variant
            1, mRNA.
ACCESSION   NM_001399252 XM_006238440
VERSION     NM_001399252.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1620)
  AUTHORS   Zhao Y, Goto M, Vaziri ND, Khazaeli M, Liu H, Farahanchi N,
            Khanifar E, Farzaneh T, Haslett PA, Moradi H and Soundarapandian
            MM.
  TITLE     RNA Interference Targeting Liver Angiopoietin-Like Protein 3
            Protects from Nephrotic Syndrome in a Rat Model Via Amelioration of
            Pathologic Hypertriglyceridemia
  JOURNAL   J Pharmacol Exp Ther 376 (3), 428-435 (2021)
   PUBMED   33443084
  REMARK    GeneRIF: RNA Interference Targeting Liver Angiopoietin-Like Protein
            3 Protects from Nephrotic Syndrome in a Rat Model Via Amelioration
            of Pathologic Hypertriglyceridemia.
REFERENCE   2  (bases 1 to 1620)
  AUTHORS   Essalmani R, Susan-Resiga D, Chamberland A, Asselin MC, Canuel M,
            Constam D, Creemers JW, Day R, Gauthier D, Prat A and Seidah NG.
  TITLE     Furin is the primary in vivo convertase of angiopoietin-like 3 and
            endothelial lipase in hepatocytes
  JOURNAL   J Biol Chem 288 (37), 26410-26418 (2013)
   PUBMED   23918928
REFERENCE   3  (bases 1 to 1620)
  AUTHORS   Quagliarini F, Wang Y, Kozlitina J, Grishin NV, Hyde R, Boerwinkle
            E, Valenzuela DM, Murphy AJ, Cohen JC and Hobbs HH.
  TITLE     Atypical angiopoietin-like protein that regulates ANGPTL3
  JOURNAL   Proc Natl Acad Sci U S A 109 (48), 19751-19756 (2012)
   PUBMED   23150577
REFERENCE   4  (bases 1 to 1620)
  AUTHORS   Sonnenburg WK, Yu D, Lee EC, Xiong W, Gololobov G, Key B, Gay J,
            Wilganowski N, Hu Y, Zhao S, Schneider M, Ding ZM, Zambrowicz BP,
            Landes G, Powell DR and Desai U.
  TITLE     GPIHBP1 stabilizes lipoprotein lipase and prevents its inhibition
            by angiopoietin-like 3 and angiopoietin-like 4
  JOURNAL   J Lipid Res 50 (12), 2421-2429 (2009)
   PUBMED   19542565
REFERENCE   5  (bases 1 to 1620)
  AUTHORS   Shimamura M, Matsuda M, Yasumo H, Okazaki M, Fujimoto K, Kono K,
            Shimizugawa T, Ando Y, Koishi R, Kohama T, Sakai N, Kotani K,
            Komuro R, Ishida T, Hirata K, Yamashita S, Furukawa H and Shimomura
            I.
  TITLE     Angiopoietin-like protein3 regulates plasma HDL cholesterol through
            suppression of endothelial lipase
  JOURNAL   Arterioscler Thromb Vasc Biol 27 (2), 366-372 (2007)
   PUBMED   17110602
REFERENCE   6  (bases 1 to 1620)
  AUTHORS   Inaba T, Matsuda M, Shimamura M, Takei N, Terasaka N, Ando Y,
            Yasumo H, Koishi R, Makishima M and Shimomura I.
  TITLE     Angiopoietin-like protein 3 mediates hypertriglyceridemia induced
            by the liver X receptor
  JOURNAL   J Biol Chem 278 (24), 21344-21351 (2003)
   PUBMED   12672813
REFERENCE   7  (bases 1 to 1620)
  AUTHORS   Ando Y, Shimizugawa T, Takeshita S, Ono M, Shimamura M, Koishi R
            and Furukawa H.
  TITLE     A decreased expression of angiopoietin-like 3 is protective against
            atherosclerosis in apoE-deficient mice
  JOURNAL   J Lipid Res 44 (6), 1216-1223 (2003)
   PUBMED   12671033
REFERENCE   8  (bases 1 to 1620)
  AUTHORS   Shimamura M, Matsuda M, Kobayashi S, Ando Y, Ono M, Koishi R,
            Furukawa H, Makishima M and Shimomura I.
  TITLE     Angiopoietin-like protein 3, a hepatic secretory factor, activates
            lipolysis in adipocytes
  JOURNAL   Biochem Biophys Res Commun 301 (2), 604-609 (2003)
   PUBMED   12565906
REFERENCE   9  (bases 1 to 1620)
  AUTHORS   Shimizugawa T, Ono M, Shimamura M, Yoshida K, Ando Y, Koishi R,
            Ueda K, Inaba T, Minekura H, Kohama T and Furukawa H.
  TITLE     ANGPTL3 decreases very low density lipoprotein triglyceride
            clearance by inhibition of lipoprotein lipase
  JOURNAL   J Biol Chem 277 (37), 33742-33748 (2002)
   PUBMED   12097324
REFERENCE   10 (bases 1 to 1620)
  AUTHORS   Camenisch G, Pisabarro MT, Sherman D, Kowalski J, Nagel M, Hass P,
            Xie MH, Gurney A, Bodary S, Liang XH, Clark K, Beresini M, Ferrara
            N and Gerber HP.
  TITLE     ANGPTL3 stimulates endothelial cell adhesion and migration via
            integrin alpha vbeta 3 and induces blood vessel formation in vivo
  JOURNAL   J Biol Chem 277 (19), 17281-17290 (2002)
   PUBMED   11877390
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000162.1.
            
            On Jan 5, 2022 this sequence version replaced XM_006238440.4.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: FQ210243.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5756307, SAMEA5760400
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-550               JACYVU010000162.1  28252306-28252855
            551-661             JACYVU010000162.1  28253410-28253520
            662-776             JACYVU010000162.1  28254620-28254734
            777-890             JACYVU010000162.1  28255755-28255868
            891-986             JACYVU010000162.1  28256122-28256217
            987-1253            JACYVU010000162.1  28258383-28258649
            1254-1620           JACYVU010000162.1  28258977-28259343
FEATURES             Location/Qualifiers
     source          1..1620
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="5"
                     /map="5q33"
     gene            1..1620
                     /gene="Angptl3"
                     /note="angiopoietin-like 3"
                     /db_xref="GeneID:502970"
                     /db_xref="RGD:1564505"
     exon            1..550
                     /gene="Angptl3"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    38..40
                     /gene="Angptl3"
                     /note="upstream in-frame stop codon"
     CDS             56..1423
                     /gene="Angptl3"
                     /note="isoform 1 precursor is encoded by transcript
                     variant 1; angiopoietin-related protein 3"
                     /codon_start=1
                     /product="angiopoietin-related protein 3 isoform 1
                     precursor"
                     /protein_id="NP_001386181.1"
                     /db_xref="GeneID:502970"
                     /db_xref="RGD:1564505"
                     /translation="
MHTIKLLLFVVPLVISSRVDPDLSPFDSVPSEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQCFYDLSLQTNEIKEEEKELRRTTSKLQVKNEEVKNMSLELNSKLESLLEEKMALQHRVRALEEQLTSLVQNPPGAREHPEVTSLKSFVEQQDNSIRELLQSVEEQYKQLSQQHIQIKEIENQLRKTGIQEPTENSLYSKPRAPRTTPPLHLKEAKNIEQDDLPADCSAIYNRGEHTSGVYTIRPSSSQVFNVYCDTQSGTPRTLIQHRKDGSQNFNQTWENYEKGFGRLDGEFWLGLEKIYAIVKQSNYILRLELQDWKDSKHYAEYSFHLGNHETNYTLHVAEIAANIPEALPEHRDLMFSTWDHRAKGQLYCPESYSGGWWFSDMCGENNLNGKYNKPRAKSKPERRRGISWRPRGGKLYSIKSSKMMLQPTT"
     sig_peptide     56..103
                     /gene="Angptl3"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    <323..>670
                     /gene="Angptl3"
                     /note="Chromosome segregation ATPase [Cell cycle control,
                     cell division, chromosome partitioning]; Region: Smc;
                     COG1196"
                     /db_xref="CDD:224117"
     misc_feature    776..1414
                     /gene="Angptl3"
                     /note="Fibrinogen-related domains (FReDs); C terminal
                     globular domain of fibrinogen. Fibrinogen is involved in
                     blood clotting, being activated by thrombin to assemble
                     into fibrin clots. The N-termini of 2 times 3 chains come
                     together to form a globular...; Region: FReD; cd00087"
                     /db_xref="CDD:238040"
     misc_feature    1130..1132
                     /gene="Angptl3"
                     /note="gamma-gamma dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238040"
     misc_feature    order(1214..1216,1220..1222,1226..1228)
                     /gene="Angptl3"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238040"
     misc_feature    order(1235..1237,1244..1249,1277..1282)
                     /gene="Angptl3"
                     /note="polymerization pocket [active]"
                     /db_xref="CDD:238040"
     exon            551..661
                     /gene="Angptl3"
                     /inference="alignment:Splign:2.1.0"
     exon            662..776
                     /gene="Angptl3"
                     /inference="alignment:Splign:2.1.0"
     exon            777..890
                     /gene="Angptl3"
                     /inference="alignment:Splign:2.1.0"
     exon            891..986
                     /gene="Angptl3"
                     /inference="alignment:Splign:2.1.0"
     exon            987..1253
                     /gene="Angptl3"
                     /inference="alignment:Splign:2.1.0"
     exon            1254..1620
                     /gene="Angptl3"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
tccttaccggaggaagacgttccaaattgcttgaaattgaataattgaaacaaaaatgcacacaattaagctgctcctttttgttgttcctctagtaatttcgtccagagttgatccagacctttcgccatttgattctgtaccgtcagagccaaaatcaagatttgctatgttggatgatgtcaaaattttagccaatggcctcctgcagctgggtcatggtcttaaagattttgtccataagacaaagggacaaattaatgacatatttcagaagctcaacatatttgatcagtgtttttatgacctatcacttcaaaccaatgaaatcaaagaagaggaaaaggagctaagaagaaccacatctaaactacaagttaaaaacgaagaggtgaagaatatgtcacttgaactgaactcaaagcttgaaagtctactggaggagaagatggcgctccaacacagagtcagggctttggaggaacagctgaccagcttggttcagaacccgcctggggctcgggagcacccagaggtaacgtcacttaaaagttttgtagaacagcaagataacagcataagagaactcctccagagtgtggaagaacaatataaacaactaagtcaacagcacattcagataaaagaaatagaaaatcagctcagaaagactggcattcaagaacccactgaaaattctctttattctaaaccaagagcaccaagaactactccccctcttcatctgaaggaagcaaaaaatatagaacaagatgatctgcctgctgactgctctgccatttataacagaggtgaacatacaagtggcgtgtatactattagaccaagcagctctcaagtgtttaatgtctactgtgacacccaatcaggcactccacggacattaattcaacaccggaaagatggctctcaaaacttcaaccaaacgtgggaaaactacgaaaagggttttgggaggcttgatggagaattctggttgggcctagagaagatctacgctatagtcaaacagtctaactacatcttacgactggagctacaagactggaaggacagcaagcactatgctgaatattcctttcatctgggcaatcatgaaaccaactacacgctacatgtggctgagattgctgccaatatccctgaggccctaccagaacacagagacctgatgttttctacatgggatcacagagcaaagggacagctctactgtccagaaagttattcaggtggctggtggttcagtgacatgtgtggagaaaacaacctaaatggtaaatacaacaaacccagagccaaatccaaaccagagcggagaagagggatctcctggaggcctcggggcggaaagctctactctatcaaatcatctaaaatgatgctccagccgaccacctaaggaagcgtcagctgaactgagacaaattaaaagaccaacacattcaatattaaaatccgcccgcacactgtagtacagcaatctggtattaaatctttagtggaaagcttaagaattgaatttcaattaactttaaagtcattgttaagatcagatatcattgcatcaatataacacaatttatattttcaatcaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]