2025-03-02 05:37:40, GGRNA.v2 : RefSeq release 228 (Jan, 2025)
LOCUS NM_001329893 1720 bp mRNA linear ROD 12-DEC-2024 DEFINITION Rattus norvegicus selenium binding protein 1 (Selenbp1), mRNA. ACCESSION NM_001329893 NM_080892 XM_008761279 XM_008775217 VERSION NM_001329893.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1720) AUTHORS Wang,J., Qu,D., An,J., Yuan,G. and Liu,Y. TITLE Integrated microarray analysis provided novel insights to the pathogenesis of glaucoma JOURNAL Mol Med Rep 16 (6), 8735-8746 (2017) PUBMED 28990066 REFERENCE 2 (bases 1 to 1720) AUTHORS Lee,E.K., Shin,Y.J., Park,E.Y., Kim,N.D., Moon,A., Kwack,S.J., Son,J.Y., Kacew,S., Lee,B.M., Bae,O.N. and Kim,H.S. TITLE Selenium-binding protein 1: a sensitive urinary biomarker to detect heavy metal-induced nephrotoxicity JOURNAL Arch Toxicol 91 (4), 1635-1648 (2017) PUBMED 27578022 REMARK GeneRIF: SBP1 may play a critical role in the pathological processes underlying chemical-induced nephrotoxicity; urinary excretion of SBP1 might be a sensitive and specific biomarker to detect early stages of kidney injury. REFERENCE 3 (bases 1 to 1720) AUTHORS Gonzales,P.A., Pisitkun,T., Hoffert,J.D., Tchapyjnikov,D., Star,R.A., Kleta,R., Wang,N.S. and Knepper,M.A. TITLE Large-scale proteomics and phosphoproteomics of urinary exosomes JOURNAL J Am Soc Nephrol 20 (2), 363-379 (2009) PUBMED 19056867 REFERENCE 4 (bases 1 to 1720) AUTHORS Wu,Y. and Smas,C.M. TITLE Wdnm1-like, a new adipokine with a role in MMP-2 activation JOURNAL Am J Physiol Endocrinol Metab 295 (1), E205-E215 (2008) PUBMED 18492766 REFERENCE 5 (bases 1 to 1720) AUTHORS Palmer,D.J., Kelly,V.C., Smit,A.M., Kuy,S., Knight,C.G. and Cooper,G.J. TITLE Human colostrum: identification of minor proteins in the aqueous phase by proteomics JOURNAL Proteomics 6 (7), 2208-2216 (2006) PUBMED 16502470 REFERENCE 6 (bases 1 to 1720) AUTHORS Florea,L., Di Francesco,V., Miller,J., Turner,R., Yao,A., Harris,M., Walenz,B., Mobarry,C., Merkulov,G.V., Charlab,R., Dew,I., Deng,Z., Istrail,S., Li,P. and Sutton,G. TITLE Gene and alternative splicing annotation with AIR JOURNAL Genome Res 15 (1), 54-66 (2005) PUBMED 15632090 REFERENCE 7 (bases 1 to 1720) AUTHORS Lanfear,J., Fleming,J., Walker,M. and Harrison,P. TITLE Different patterns of regulation of the genes encoding the closely related 56 kDa selenium- and acetaminophen-binding proteins in normal tissues and during carcinogenesis JOURNAL Carcinogenesis 14 (3), 335-340 (1993) PUBMED 8453708 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC074008.1. On or before Feb 28, 2022 this sequence version replaced NM_080892.1, XM_008761279.1, XM_008775217.1. ##Evidence-Data-START## Transcript exon combination :: BC074008.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5756307, SAMEA5760383 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1720 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="2" /map="2q34" gene 1..1720 /gene="Selenbp1" /gene_synonym="MTO; rSBP; Selenbp2" /note="selenium binding protein 1" /db_xref="GeneID:103689947" /db_xref="RGD:620571" exon 1..76 /gene="Selenbp1" /gene_synonym="MTO; rSBP; Selenbp2" /inference="alignment:Splign:2.1.0" CDS 73..1491 /gene="Selenbp1" /gene_synonym="MTO; rSBP; Selenbp2" /EC_number="1.8.3.4" /note="SP56; SBP56; selenium-binding protein 2; 56 kDa selenium-binding protein" /codon_start=1 /product="methanethiol oxidase" /protein_id="NP_001316822.1" /db_xref="GeneID:103689947" /db_xref="RGD:620571" /translation="
MATKCTKCGPGYATPLEAMKGPREEIVYLPCIYRNTGIEAPDYLATVDVDPKSPHYSQVIHRLPMPHLKDELHHSGWNTCSSCFGDSTKSRDKLILPSIISSRIYVVDVGSEPRAPKLHKVIEPNEIHAKCNLGNLHTSHCLASGEVMISSLGDPQGNGKGGFVLLDGETFEVKGTWEKPGGEAPMGYDFWYQPRHNIMVSTEWAAPNVFKDGFNPAHVEAGLYGSHIHVWDWQRHEIIQTLQMKDGLIPLEIRFLHDPDATQGFVGCALSSNIQRFYKNEGGTWSVEKVIQVPSKKVKGWMLPEMPGLITDILLSLDDRFLYFSNWLHGDIRQYDISNPKKPRLTGQIFLGGSIVKGGSVQVLEDQELTCQPEPLVVKGKRVPGGPQMIQLSLDGKRLYVTTSLYSAWDKQFYPNLIREGSVMLQIDVDTANGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI"
misc_feature 76..78 /gene="Selenbp1" /gene_synonym="MTO; rSBP; Selenbp2" /note="N-acetylalanine. /evidence=ECO:0000250|UniProtKB:Q13228; propagated from UniProtKB/Swiss-Prot (Q8VIF7.1); acetylation site" misc_feature 91..1488 /gene="Selenbp1" /gene_synonym="MTO; rSBP; Selenbp2" /note="56kDa selenium binding protein (SBP56); Region: SBP56; pfam05694" /db_xref="CDD:461716" misc_feature 403..405 /gene="Selenbp1" /gene_synonym="MTO; rSBP; Selenbp2" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:Q13228; propagated from UniProtKB/Swiss-Prot (Q8VIF7.1); phosphorylation site" misc_feature 1471..1473 /gene="Selenbp1" /gene_synonym="MTO; rSBP; Selenbp2" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:P17563; propagated from UniProtKB/Swiss-Prot (Q8VIF7.1); phosphorylation site" exon 77..133 /gene="Selenbp1" /gene_synonym="MTO; rSBP; Selenbp2" /inference="alignment:Splign:2.1.0" exon 134..246 /gene="Selenbp1" /gene_synonym="MTO; rSBP; Selenbp2" /inference="alignment:Splign:2.1.0" exon 247..432 /gene="Selenbp1" /gene_synonym="MTO; rSBP; Selenbp2" /inference="alignment:Splign:2.1.0" exon 433..553 /gene="Selenbp1" /gene_synonym="MTO; rSBP; Selenbp2" /inference="alignment:Splign:2.1.0" exon 554..736 /gene="Selenbp1" /gene_synonym="MTO; rSBP; Selenbp2" /inference="alignment:Splign:2.1.0" exon 737..915 /gene="Selenbp1" /gene_synonym="MTO; rSBP; Selenbp2" /inference="alignment:Splign:2.1.0" exon 916..994 /gene="Selenbp1" /gene_synonym="MTO; rSBP; Selenbp2" /inference="alignment:Splign:2.1.0" exon 995..1116 /gene="Selenbp1" /gene_synonym="MTO; rSBP; Selenbp2" /inference="alignment:Splign:2.1.0" exon 1117..1209 /gene="Selenbp1" /gene_synonym="MTO; rSBP; Selenbp2" /inference="alignment:Splign:2.1.0" exon 1210..1328 /gene="Selenbp1" /gene_synonym="MTO; rSBP; Selenbp2" /inference="alignment:Splign:2.1.0" exon 1329..1695 /gene="Selenbp1" /gene_synonym="MTO; rSBP; Selenbp2" /inference="alignment:Splign:2.1.0" ORIGIN
ccagcactggtctctgctgaacctttgtccattcctagcaaatcctgcaggaccagagtgtcagccagcagcatggctacaaaatgcacaaagtgtggtccaggttatgcgacccctctggaggccatgaaaggaccccgagaggagattgtctacttgccctgcatttaccgaaacacaggcattgaagccccggattatttggccacagtggatgttgaccccaagtctccccattatagccaggtcatccataggctgcccatgccccacctgaaggacgagctgcaccactcagggtggaacacctgcagtagctgctttggggacagcaccaagtcacgcgacaagctgatactgcccagcatcatctcctcccgcatctatgtggtggatgtgggctctgagcctcgtgccccgaagttgcacaaggtcattgagcccaatgaaatccatgccaagtgcaacctgggcaatctgcacaccagccactgcctggccagcggagaggtgatgatcagctccttgggggatccccaggggaatggcaaagggggttttgtgctgctggatggggagaccttcgaggtgaaagggacgtgggagaagcctgggggtgaagctccaatgggctatgacttctggtaccagcctcgacacaacatcatggtcagcactgaatgggcagctcccaatgtcttcaaagatggcttcaaccctgctcatgtggaggctgggctgtatgggagccacatacatgtgtgggactggcagcgacatgagattatccagaccctgcaaatgaaagatgggctgatccccctggagatccgcttcctgcacgacccagatgccacccagggctttgtaggctgcgccctcagctccaacatccagcgcttctacaagaatgagggaggcacctggtcagtggagaaggtgatccaggtgccctccaagaaagtgaagggctggatgttgccagaaatgcctggtttgatcaccgacatcttgctgtccctggatgaccgcttcctctacttcagcaactggctgcacggggacattcggcagtatgacatctctaacccgaagaagcctcgcctcactgggcagatcttccttgggggcagcattgttaaaggaggctctgtacaagtgctggaggaccaagagctaacgtgtcagccggagcccctagtggtcaagggaaaacgagttcctggaggtcctcagatgatccagctcagcttagatgggaagcgtctttacgtcactacatcactgtacagcgcctgggacaagcagttttaccctaatctcattagggaaggctctgtgatgctgcaaattgatgtagatacagcaaatggagggctgaagttgaaccccaactttctggtggactttgggaaagagcctcttgggccagcactggctcatgagcttcgttacccagggggtgattgcagttctgacatctggatctgaaggctagccctaaaggccttcctccacagtcggggtcctccttctgaggagcctagcttcgctctgctctgggtcccaactctccaaggccatgatgagaccatcgagaactgcagagcagtatctcactactaccttgcttgttgtttgtgccattcttaagtgagctcctggaagcaccaagaaataaaatgctgaacctttaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]