GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-20 16:22:37, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001191649             973 bp    mRNA    linear   ROD 23-MAR-2023
DEFINITION  Rattus norvegicus homeo box B8 (Hoxb8), mRNA.
ACCESSION   NM_001191649 XM_220888
VERSION     NM_001191649.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 973)
  AUTHORS   Holstege JC, de Graaff W, Hossaini M, Cardona Cano S, Jaarsma D,
            van den Akker E and Deschamps J.
  TITLE     Loss of Hoxb8 alters spinal dorsal laminae and sensory responses in
            mice
  JOURNAL   Proc Natl Acad Sci U S A 105 (17), 6338-6343 (2008)
   PUBMED   18430798
REFERENCE   2  (bases 1 to 973)
  AUTHORS   El-Mounayri O, Triplett JW, Yates CW and Herring BP.
  TITLE     Regulation of smooth muscle-specific gene expression by homeodomain
            proteins, Hoxa10 and Hoxb8
  JOURNAL   J Biol Chem 280 (27), 25854-25863 (2005)
   PUBMED   15886193
REFERENCE   3  (bases 1 to 973)
  AUTHORS   Medina-Martinez O and Ramirez-Solis R.
  TITLE     In vivo mutagenesis of the Hoxb8 hexapeptide domain leads to
            dominant homeotic transformations that mimic the loss-of-function
            mutations in genes of the Hoxb cluster
  JOURNAL   Dev Biol 264 (1), 77-90 (2003)
   PUBMED   14623233
REFERENCE   4  (bases 1 to 973)
  AUTHORS   Greer JM and Capecchi MR.
  TITLE     Hoxb8 is required for normal grooming behavior in mice
  JOURNAL   Neuron 33 (1), 23-34 (2002)
   PUBMED   11779477
REFERENCE   5  (bases 1 to 973)
  AUTHORS   Knoepfler PS, Sykes DB, Pasillas M and Kamps MP.
  TITLE     HoxB8 requires its Pbx-interaction motif to block differentiation
            of primary myeloid progenitors and of most cell line models of
            myeloid differentiation
  JOURNAL   Oncogene 20 (39), 5440-5448 (2001)
   PUBMED   11571641
REFERENCE   6  (bases 1 to 973)
  AUTHORS   Medina-Martinez O, Bradley A and Ramirez-Solis R.
  TITLE     A large targeted deletion of Hoxb1-Hoxb9 produces a series of
            single-segment anterior homeotic transformations
  JOURNAL   Dev Biol 222 (1), 71-83 (2000)
   PUBMED   10885747
REFERENCE   7  (bases 1 to 973)
  AUTHORS   van den Akker E, Reijnen M, Korving J, Brouwer A, Meijlink F and
            Deschamps J.
  TITLE     Targeted inactivation of Hoxb8 affects survival of a spinal
            ganglion and causes aberrant limb reflexes
  JOURNAL   Mech Dev 89 (1-2), 103-114 (1999)
   PUBMED   10559485
REFERENCE   8  (bases 1 to 973)
  AUTHORS   Iimura T, Oida S, Takeda K, Maruoka Y and Sasaki S.
  TITLE     Changes in homeobox-containing gene expression during ectopic bone
            formation induced by bone morphogenetic protein
  JOURNAL   Biochem Biophys Res Commun 201 (2), 980-987 (1994)
   PUBMED   7911662
REFERENCE   9  (bases 1 to 973)
  AUTHORS   Chung SY, Dai PH, Lei J, Riviere M, Levan G, Szpirer J and Szpirer
            C.
  TITLE     Chromosomal assignment of seven rat homeobox genes to rat
            chromosomes 3, 4, 7, and 10
  JOURNAL   Mamm Genome 4 (9), 537-540 (1993)
   PUBMED   7906969
REFERENCE   10 (bases 1 to 973)
  AUTHORS   Falzon M and Chung SY.
  TITLE     The expression of rat homeobox-containing genes is developmentally
            regulated and tissue specific
  JOURNAL   Development 103 (3), 601-610 (1988)
   PUBMED   2907739
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from
            JACYVU010000220.1.
            
            On Jul 17, 2010 this sequence version replaced XM_220888.4.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-424               JACYVU010000220.1  38073745-38074168
            425-973             JACYVU010000220.1  38074948-38075496
FEATURES             Location/Qualifiers
     source          1..973
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="10"
                     /map="10q26"
     gene            1..973
                     /gene="Hoxb8"
                     /gene_synonym="Hox2r1a"
                     /note="homeo box B8"
                     /db_xref="GeneID:24457"
                     /db_xref="RGD:1586211"
     CDS             1..732
                     /gene="Hoxb8"
                     /gene_synonym="Hox2r1a"
                     /note="Hox2.4 homeobox homolog; homeobox gene B8; homeobox
                     protein R1a"
                     /codon_start=1
                     /product="homeobox protein Hox-B8"
                     /protein_id="NP_001178578.1"
                     /db_xref="GeneID:24457"
                     /db_xref="RGD:1586211"
                     /translation="
MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKEKLERAPETAEQGDAQKGDKK"
     misc_feature    order(439..453,457..459,508..510,526..528,565..567,
                     571..576,583..588,592..600,604..609)
                     /gene="Hoxb8"
                     /gene_synonym="Hox2r1a"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(445..447,454..456,574..576,583..588,595..597)
                     /gene="Hoxb8"
                     /gene_synonym="Hox2r1a"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    448..606
                     /gene="Hoxb8"
                     /gene_synonym="Hox2r1a"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     exon            1..424
                     /gene="Hoxb8"
                     /gene_synonym="Hox2r1a"
                     /inference="alignment:Splign:2.1.0"
     exon            425..973
                     /gene="Hoxb8"
                     /gene_synonym="Hox2r1a"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgagctcttatttcgtcaactcactgttctccaaatacaaaaccggggagtccctgcgccccaattattatgactgcggcttcgcccaggacctgggcggccgacccaccgtggtgtacggtcccagcagcggcggcagcttccagcacccttcgcaaatccaggagttctaccacgggccatcgtcgctgtccacggctccctaccagcagaacccgtgcgccgtggcgtgccacggggacccgggcaacttctacggctacgaccctctgcagcgccagagcctgttcggtgcgcaggatccagacctggtgcagtacgcagactgcaagctcgcggcagccagcggcctgggcgaggaggccgaggggtctgagcagagcccgtcgcccacacagctcttcccctggatgcgccctcaagcagccgccggacgcaggcgaggccgccagacctacagccgctaccagaccctggagctggagaaggagttcctatttaatccctatctgactcgcaagcggaggatcgaggtatcgcacgcgctgggactgacagaaagacaggtcaaaatctggttccagaatcggagaatgaagtggaaaaaggagaacaacaaagacaagttccccagcagtaaatgcgagcaggaggagctggagaaagagaagctggagcgggcgccagagaccgccgagcagggcgatgcgcagaagggtgacaaaaagtaggctccagctgggactgctcgggcccggactagcccgcacgtccgccggtccctcccgcgaccacgccgccgccgcccgccccccgcctccgagagctccggccccgcgagcggagccaggagctgggcctcccaccgcagcgtcccccgccgcgccagtccccgctagtggtagtatctcgtaatagcttctgtgtgtgagctaccgtggatctccttcccttctcttgggggtccgaggg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]